(data stored in ACNUC7421 zone)

EMBL: CP001825.PE180

CP001825.PE180       Location/Qualifiers
FT   CDS_pept        194812..195408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0182"
FT                   /product="O-methyltransferase family 3"
FT                   /note="PFAM: O-methyltransferase family 3; KEGG:
FT                   scl:sce1553 O-methyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41104"
FT                   /db_xref="GOA:D1CDU8"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDU8"
FT                   /inference="protein motif:PFAM:PF01596"
FT                   /protein_id="ACZ41104.1"
FT                   /translation="MDIKDYFASEPNTPEVLSKILVETDQLGFTMGSDVVTGSLLRALV
FT                   ASKPGGRFLEIGTGTGIATSWLLQGMDQDSILITLEKEDKFASIARKYLGNDPRVTFHL
FT                   VDAGTWLEQNQHEEFDLIFADSWPGKYSHLNEALSILKLGGIYVIDDMLPQPNWPEGHE
FT                   ASVRWLLNELASRSDLVIAKLACSTGLVLATKVTQ"
     gtggatatca aagattactt tgcatcagag cccaatacac cagaggtact atccaagata        60
     ctggtagaaa ctgaccagct tgggtttacc atgggttcgg atgtcgtaac gggctcgcta       120
     ctacgtgcac tagttgcttc aaagccggga ggtagattcc ttgagattgg tactggaact       180
     ggaattgcta cctcctggct actacaaggc atggatcaag attctatctt gataacttta       240
     gagaaagagg ataaattcgc ctccatagct cgtaagtatc ttgggaacga tcccagagtc       300
     acattccact tagtagatgc aggaacctgg ctagagcaaa accagcacga agagtttgac       360
     ctaatatttg ctgactcctg gccaggtaaa tacagccact taaacgaggc tttaagcata       420
     ctcaagctcg gaggcatcta cgtaatagat gacatgctgc ctcaacctaa ctggccggaa       480
     gggcatgagg caagcgtcag atggttgcta aatgagcttg caagcaggag cgatcttgtt       540
     attgcaaagc tagcctgctc tacaggtctg gtattggcaa ccaaagttac ccaataa          597
//

If you have problems or comments...

PBIL Back to PBIL home page