(data stored in ACNUC7421 zone)

EMBL: CP001825.PE183

CP001825.PE183       Location/Qualifiers
FT   CDS_pept        197953..198858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0185"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bha:BH1866 sugar transport
FT                   system (permease) (binding protein dependent transporter)"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41107"
FT                   /db_xref="GOA:D1CDV1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDV1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ41107.1"
FT                   /translation="MATTTTARTSAAEKPTYLYKVQSLAVKVLVYMVLLLGLSIVIIPI
FT                   YWMIATSLKTDTALFLIPPQWFPDPIQWSNYIEVWQLVPLARYFANSVFVTLLAILGEI
FT                   ITSALVAYGFARFRFPGRGVLFSIMLATMMLPSIITLIPSFIIWARWLGRYDTYSPLTV
FT                   GSLFAWGPAYIFLLRQFFLTIPRDIEEAAIIDGGNLLQIFGYVMLPLVRPALLAITILS
FT                   FTGNWNNFLSPLIYLSTPEKFTLPLGLYQFNKSLAGGSEAPKWNMMMAMAVLMTIPIIV
FT                   LYFRAQRYFIEGITVGAVKG"
     atggcgacta cgacaacagc aagaacaagc gctgccgaga agcctacgta tctatataaa        60
     gtacagagcc ttgccgtcaa agtcctcgtt tacatggttc tgctacttgg tttgtcaata       120
     gtcatcatcc ctatatactg gatgattgca acttcactca aaaccgatac tgccctgttt       180
     ctcataccgc cacaatggtt tcctgaccca atacaatgga gcaactatat agaggtatgg       240
     caactagttc cactagcacg atatttcgcc aacagtgtat tcgtcacctt actggccata       300
     ttgggtgaga tcattacctc agcgcttgtg gcttatggct tcgcacgctt taggtttcct       360
     ggtcgaggag tgctctttag catcatgctg gcgaccatga tgctcccaag catcattacg       420
     ctaataccgt catttatcat atgggccaga tggctaggaa gatacgacac ttattctccc       480
     ctcaccgttg gatcactgtt tgcatgggga ccagcctaca ttttcttgtt gaggcaattt       540
     ttcctcacaa tacccaggga catagaagag gcagccatca tagatggagg gaatttattg       600
     cagatattcg gatacgtaat gttgcccttg gtcaggccgg cactgctagc aattaccata       660
     ctcagcttca caggtaactg gaacaatttc ctctcacccc taatctacct gagcactccg       720
     gagaaattta ctctaccgct aggcctgtat cagttcaaca agtcactggc tggaggatcc       780
     gaagctccca aatggaacat gatgatggcc atggctgtgc tcatgactat acctataata       840
     gttctctact ttagagctca aaggtacttt atagaaggaa ttaccgtagg tgctgtcaaa       900
     ggctaa                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page