(data stored in ACNUC7421 zone)

EMBL: CP001825.PE186

CP001825.PE186       Location/Qualifiers
FT   CDS_pept        201699..202706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0188"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="KEGG: scl:sce3732 ketol-acid reductoisomerase;
FT                   TIGRFAM: ketol-acid reductoisomerase; PFAM: Acetohydroxy
FT                   acid isomeroreductase catalytic domain protein;
FT                   acetohydroxy acid isomeroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41110"
FT                   /db_xref="GOA:D1CDV4"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDV4"
FT                   /inference="protein motif:TFAM:TIGR00465"
FT                   /protein_id="ACZ41110.1"
FT                   /translation="MAQVYYDADADINVIKDKLIAIIGYGSQGHAHALNLHDSGCNVIV
FT                   GLHEGSKSAEKARNDGLEVRSVAEAAEAADIIMMLIPDTIHKKVYEESIAPAMRAGKTL
FT                   MFAHGFSIHYGQVKPPAEVDVVMVAPKSPGHIMRNLFTQGIGVPALLAVYQDASGQAEQ
FT                   TGLAYAKGLGCTRAGVLKTTFKEETETDLFGEQTVLCGGVSALIKAGFETLVEAGYQPE
FT                   IAYFECLNEMKLIVDLIYQGGLSYMRYSISDTAEYGDYVAGPRIIDEHVRENMKQILKE
FT                   IQDGSFARRWIEENEKGRPEFEKMREQDRNHLIEQVGQKLRAMMSWTQPQPANR"
     atggcacaag tttactacga tgcagatgct gacataaacg ttatcaagga taagctcata        60
     gcgatcattg gctatggcag tcaagggcat gcgcacgctc taaacctgca cgattctggt       120
     tgcaatgtaa tagtaggact acatgaaggt agcaagagcg cagaaaaggc tcggaacgac       180
     ggtttggaag ttagatccgt agcagaggca gcagaagctg cagatattat catgatgctc       240
     atccctgaca ctatacacaa gaaagtgtat gaggaatcca tagcgccagc aatgagagct       300
     ggaaagacgc tgatgttcgc acatggtttc agcatccatt acggacaggt gaaacctccc       360
     gcagaagttg atgtagtcat ggtagcccca aagagccccg gccacattat gcgtaacctg       420
     ttcactcagg gaataggggt accagcactg ctggctgtat atcaggatgc tagtggtcag       480
     gccgaacaga caggcttagc atatgccaaa ggactaggat gtactagggc aggggtgcta       540
     aagaccacat ttaaagaaga gactgaaact gacctgtttg gtgagcaaac agtgctctgt       600
     ggtggtgtta gcgcactgat caaggccgga tttgagactc tagtagaagc gggctatcaa       660
     cccgaaatag cttacttcga gtgtctgaat gagatgaagc tcatcgtaga cctgatctat       720
     cagggagggc tcagttacat gcgatacagc ataagcgata ccgctgagta cggggactac       780
     gtagcagggc ccagaataat cgatgagcat gtcagagaaa acatgaagca gatcctaaag       840
     gagattcagg acggaagctt cgcacgaaga tggatagagg agaacgagaa gggtagacct       900
     gagttcgaga agatgagaga gcaggacagg aaccacctca tcgagcaagt agggcagaag       960
     cttagggcaa tgatgagctg gacacaacca caaccagcta acaggtag                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page