(data stored in ACNUC7421 zone)

EMBL: CP001825.PE19

CP001825.PE19        Location/Qualifiers
FT   CDS_pept        complement(20558..21637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0020"
FT                   /product="putative RNA methylase"
FT                   /note="PFAM: putative RNA methylase; Methyltransferase type
FT                   11; methyltransferase small; KEGG: THUMPD3; THUMP domain
FT                   containing 3"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40943"
FT                   /db_xref="GOA:D1CDD7"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDD7"
FT                   /inference="protein motif:PFAM:PF01170"
FT                   /protein_id="ACZ40943.1"
FT                   /translation="MRLLLHTAPGLGGILQKQLQSSAGNIRFLSRRFVSDKNDLLVVDA
FT                   ESLQEVLTSRVVEDAFFLFLYRDNISPNMQGLRDLGRVLASAIKTDRWQEAIRYRFDQL
FT                   PASRRKHRVVTFRPVVRLQGSHVFTRSQLRATAEEILVSTLPRNWRLVKDNSLVEVWIT
FT                   VIDNEVWGGVRLTPDYSKRYAYKQYHVEASLRPSIAAAMVWLSCPRNDDVFLDPFCGAG
FT                   TILIERALAGRYRLIIGSDKSREAIEVASSNIGPRYKPIELHQWDATSIPLEHDSVDAI
FT                   VTNPPFGYRYGSKESNKELYPAFLQEAGRILKPDGRLVVVTTEDKLMRHLIGQDWRELV
FT                   TVKVWVLGMRATIFAMERR"
     atgagacttc tgctacatac agcgccagga cttggtggaa ttcttcagaa acagcttcag        60
     tcgtctgcag ggaatattag atttctctcc agaagatttg ttagcgataa aaacgaccta       120
     ttggtagtcg atgctgaatc tctgcaggag gtcctgacat ccagggtcgt agaggatgcg       180
     ttcttcttgt tcctctacag ggataacata agccctaaca tgcagggcct aagggattta       240
     ggtcgagtcc tggcgtcagc catcaaaaca gacagatggc aagaagccat taggtacaga       300
     tttgatcaac tgcctgcaag ccgtagaaaa catagagtag ttacctttcg cccagtagtt       360
     cgactccaag gcagtcatgt tttcactaga tctcagctca gggctactgc agaagaaatc       420
     ctggtctcaa ctttgcctag aaattggaga ctagttaagg acaattccct tgtagaagtt       480
     tggattactg tcatagacaa tgaggtctgg ggaggtgtaa ggcttactcc tgactattcg       540
     aaaagatacg cttacaaaca gtatcatgtg gaggcatcac taagaccatc gatagccgcg       600
     gctatggtgt ggttgtcttg cccgagaaac gatgacgtgt tccttgatcc gttctgtggg       660
     gccggtacca tactgataga acgggctctg gctggtagat accggcttat cataggtagt       720
     gataaatcta gagaagctat tgaggttgcc agttctaaca tagggccaag atataaacca       780
     atagagcttc atcaatggga tgctaccagc atacctcttg aacacgattc tgtggatgcg       840
     atagtaacta atccgccctt tggttaccgc tatggatcca aagagagtaa taaagagctc       900
     tacccagctt ttctgcagga ggctggtaga atactcaagc ctgatggcag gctggtagtg       960
     gtgactacgg aggataagct gatgcgtcac ttgatcgggc aagattggcg ggagttagtc      1020
     acagttaagg tgtgggtgct aggtatgaga gccactatat ttgctatgga gaggagatag      1080
//

If you have problems or comments...

PBIL Back to PBIL home page