(data stored in ACNUC7421 zone)

EMBL: CP001825.PE191

CP001825.PE191       Location/Qualifiers
FT   CDS_pept        206278..207876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0193"
FT                   /product="2-isopropylmalate synthase/homocitrate synthase
FT                   family protein"
FT                   /note="TIGRFAM: 2-isopropylmalate synthase/homocitrate
FT                   synthase family protein; PFAM: LeuA allosteric
FT                   (dimerisation) domain; pyruvate carboxyltransferase; KEGG:
FT                   afw:Anae109_1753 putative alpha-
FT                   isopropylmalate/homocitrate synthase family transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41115"
FT                   /db_xref="GOA:D1CDV9"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005675"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDV9"
FT                   /inference="protein motif:TFAM:TIGR00977"
FT                   /protein_id="ACZ41115.1"
FT                   /translation="MRQIKIYDTTLRDGSQMEGISFSVEDKLKLTRRLDELGVHYIEGG
FT                   WPGSNPKDAEYFERMKNIPLKNAKLAAFGSTRRAYASVEEDLNLRMLIEAGTPVITLVG
FT                   KSWDMQVHVVLGCSLEENLAMIKDSIAFCKSYGKEVFFDAEHFFDGYKNNPDYAMRCIH
FT                   AAIEAGADAVVLCDTNGGRMPEEIAQAVEKVVEETRAIAATRPFDVGIHTHNDSELAVA
FT                   NTLIAVQKGATQVQGTINGYGERIGNANLCSIIANLELKYGYHTIGREKVKELTSVSRY
FT                   FAEVANMAHDERLPYVGAKAFTHKAGLHVNAVAKSAETYEHLPPELVGNTRRVTISELG
FT                   GRSNVLMKMAQFGLEAHTSSEQVRQVLEEVKRLEKEGFQFEDAEASFELLVLRAQPDYE
FT                   PPFRLLDFMVVSESRNGGEFLSEATVKIKVGNEVMHTAADGDGPVNALDRAMRKALAPF
FT                   YPELDPVHLTDYKVRVLDNESGTAATVRVWIQSTDGKSTWNTVGSSTNIIEASWLALAD
FT                   SLEYPLRSISKRRLR"
     ttgagacaga taaagatcta tgacactact ttaagagatg gctctcaaat ggaggggatt        60
     tccttctctg tcgaggacaa gctgaagttg acaaggcgcc tcgacgagct tggagttcat       120
     tacattgagg ggggctggcc aggttccaat cctaaggacg ccgaatactt tgagaggatg       180
     aagaacattc ctctcaagaa tgctaagctg gcagctttcg gctcaacgcg aagagcatac       240
     gcatccgttg aggaagacct gaacctgagg atgctgatcg aagctggcac tccagtcata       300
     actctggtag gcaagagttg ggacatgcag gtacacgtgg tgctaggttg ctcgttagaa       360
     gagaacctag ctatgatcaa agattccata gcattctgta agtcctacgg caaggaagta       420
     ttctttgatg cagagcactt ctttgacgga tacaagaata atcctgacta cgctatgcga       480
     tgtatacacg cggctataga ggctggggcg gatgctgtag tgctgtgcga taccaacggg       540
     ggtagaatgc ccgaggagat agcgcaggcc gttgagaagg tcgtagaaga gacgagagca       600
     atagcagcga caaggccctt tgacgtcggc atacacaccc acaacgactc tgaattggca       660
     gtagccaaca ccttgatagc cgtgcaaaaa ggcgctaccc aggtccaagg gactataaat       720
     ggctatggtg agcgtatagg caatgctaac ctctgctcga taatagccaa tctggaactg       780
     aaatacggtt accacactat tggccgagaa aaggtaaagg agcttacgtc tgtctcaagg       840
     tacttcgctg aagtagctaa catggctcat gacgaaagac taccctatgt tggggcaaaa       900
     gcctttacac ataaagctgg gctgcatgtc aacgctgtag ccaaatcggc tgagacttac       960
     gaacacctac cacctgagct agtcggaaac accaggcgag taactatatc cgagctgggt      1020
     ggtagatcca acgtactcat gaagatggct cagttcggac tggaggcgca tacctcctcg      1080
     gaacaggtaa gacaggtgct cgaagaggta aaaaggcttg aaaaagaggg ttttcaattc      1140
     gaagatgctg aagcctcatt cgaactgctg gttcttcgag cacagccaga ctatgaacca      1200
     ccatttaggc tactggattt catggtcgta tccgagagcc gtaatggcgg cgagtttctg      1260
     tccgaggcaa ctgtgaagat caaggtaggt aacgaagtga tgcacacagc ggcagatggg      1320
     gacggccctg taaatgcctt ggacagggct atgcgcaagg cacttgcgcc attctatcca      1380
     gaacttgatc cagtacacct tacggactat aaggtacgag tattggataa cgaatctgga      1440
     actgctgcta cagtacgcgt atggatccag tccactgacg gtaagagcac ttggaatacc      1500
     gttggttctt caaccaacat tattgaagct agctggttgg cgcttgctga tagcttggag      1560
     tatccactcc gatcaatcag caagcgtagg ctaagataa                             1599
//

If you have problems or comments...

PBIL Back to PBIL home page