(data stored in ACNUC7421 zone)

EMBL: CP001825.PE192

CP001825.PE192       Location/Qualifiers
FT   CDS_pept        207908..209317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0194"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="KEGG: bha:BH3056 isopropylmalate isomerase large
FT                   subunit; TIGRFAM: 3-isopropylmalate dehydratase, large
FT                   subunit; PFAM: aconitate hydratase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41116"
FT                   /db_xref="GOA:D1CDW0"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDW0"
FT                   /inference="protein motif:TFAM:TIGR00170"
FT                   /protein_id="ACZ41116.1"
FT                   /translation="MAPRTLAEKVWEDHVVRRSPGEPDLLYIDLHLVHEVTSPQAFEGL
FT                   RLAGRKVRRPDLTLATMDHNVPTTGLQFGITDPISRAQVEALKKNCADFGIRLFGMGDP
FT                   RQGIVHVIGPEQGLTQPGMTIVCGDSHTSTHGAFGALAFGIGTSEVEHVLATQCLWQRK
FT                   PKMMAIEVNGELPIGVTAKDIILGIIEKIGVDGGNGHIIEYRGDTIRSLSMEQRMTICN
FT                   MSIEAGARAGMIAPDDTTFKYIEGRPHAPKGKAWEKALEYWQSLPTDEGAQFDKVVKLD
FT                   ASQLEPYVTWGTNPGQSVKITGRVPDPSEAKTPAEREAMERALKYMGLEPGTPMTEIKI
FT                   DTVFIGSCTNARIEDLRAAAKILNGRKVAKGVRAMVVPGSMQVKAQAEREGLDKIFKEA
FT                   GFEWRDSGCSMCLGMNPDILEPGKRSASTSNRNFEGRQGPGGRTHLMSPIMAAAAAVAG
FT                   HLVDVREWEVK"
     atggcaccaa ggacacttgc agagaaggtt tgggaagatc acgtagtacg tagatcacca        60
     ggagagcctg acctgcttta tattgatctg catctcgtgc atgaagttac atctcctcag       120
     gcattcgaag ggctaaggct cgcagggcgt aaagtccgta ggccagatct aactctggct       180
     acgatggacc ataatgtacc tacgaccggc cttcagtttg gaataacaga tcctatttct       240
     agagctcagg tagaggctct gaagaaaaac tgtgcagatt ttggaatcag attatttggg       300
     atgggagacc ccagacaagg catagtccac gtcataggtc ctgaacaggg actgacacag       360
     cctggaatga ccatagtttg tggagatagc cacacttcca cacacggagc ttttggcgca       420
     ctagcttttg gaatcgggac cagcgaagtt gaacacgtac tggctacaca atgtctctgg       480
     cagcgaaaac ctaagatgat ggccatagaa gtaaacggag agctgcctat aggtgttacc       540
     gctaaggata ttatccttgg catcatcgag aaaatcggcg tagatggtgg taatggccac       600
     ataatcgagt atagaggcga taccatccgc tcactctcga tggaacagag aatgaccata       660
     tgcaacatgt ccatagaggc cggtgcgaga gcaggaatga tagcgcctga tgataccact       720
     ttcaaataca ttgaagggag accccatgcc cccaaaggca aagcatggga gaaggcgctc       780
     gagtattggc aatccctgcc tacggatgag ggagcccagt tcgataaagt ggtgaagctg       840
     gatgcaagcc agcttgagcc gtacgtgaca tggggtacaa acccaggaca gtcggtgaag       900
     atcactggga gagtacccga ccccagcgaa gctaagacgc ctgcagagag ggaagctatg       960
     gagcgggcac ttaagtacat ggggcttgag cctggcaccc ccatgacaga gatcaagata      1020
     gatactgtct tcataggctc ttgtaccaat gcacgtatag aagatttaag ggctgcagct      1080
     aagatcctta atggacgcaa ggtggctaaa ggcgtgcgtg caatggttgt acccggctcc      1140
     atgcaagtca aggctcaagc tgaaagagaa ggacttgaca agatattcaa agaagctggg      1200
     ttcgagtgga gagattctgg atgctcaatg tgtcttggta tgaacccaga catactggag      1260
     cctggcaaga gaagcgcatc cacctccaac cgaaacttcg agggaagaca gggaccgggt      1320
     ggtagaaccc accttatgtc tccgattatg gctgcagctg cagctgttgc cggccacctg      1380
     gttgatgtgc gcgaatggga ggttaaataa                                       1410
//

If you have problems or comments...

PBIL Back to PBIL home page