(data stored in ACNUC7421 zone)

EMBL: CP001825.PE195

CP001825.PE195       Location/Qualifiers
FT   CDS_pept        211854..212372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41119"
FT                   /db_xref="GOA:D1CDW3"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDW3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41119.1"
FT                   /translation="MSSPPDGIELSHWEERRSIHSRANPTPLIILSLIIIVSLSGILGP
FT                   MRHRATSQNNTSVLEIEGPRFIRTGEIFEMRIHITPRTELKNTVLSVSADLWKDMTINT
FT                   MSPAPQEESSENGNFRFLFGNLSSNKEFLVKVDLQINPSLRGQNHGTIRLLSNGAEINR
FT                   VDYSIMVWP"
     atgagttctc cgcctgatgg tatagagctg tctcattggg aagagcgcag aagtatacat        60
     agtcgtgcta atccgacccc gctgattata ctctcattga tcataatagt aagcttatct       120
     ggaatattag gccctatgcg ccacagagcg acgtctcaaa acaacacttc ggtgctggag       180
     atcgaaggtc caaggttcat acgcacagga gagatctttg agatgaggat acacataact       240
     ccaagaacgg agttgaagaa cactgtgcta agtgtatctg cggatttatg gaaggatatg       300
     accataaaca caatgtctcc agctccacag gaggagtcct ccgaaaatgg caactttaga       360
     tttttgttcg gcaacctcag cagtaataaa gagttcctag taaaagtaga cttgcaaata       420
     aaccccagct tgagggggca aaaccatggc actatcagat tgcttagcaa cggtgcagaa       480
     atcaacagag ttgactactc cataatggtg tggccgtaa                              519
//

If you have problems or comments...

PBIL Back to PBIL home page