(data stored in ACNUC7421 zone)

EMBL: CP001825.PE198

CP001825.PE198       Location/Qualifiers
FT   CDS_pept        213227..213412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0200"
FT                   /product="zinc finger C2H2-type domain protein"
FT                   /note="PFAM: zinc finger C2H2-type domain protein; SMART:
FT                   Zinc finger, C2H2-like; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41122"
FT                   /db_xref="GOA:D1CDW6"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDW6"
FT                   /inference="protein motif:PFAM:PF00096"
FT                   /protein_id="ACZ41122.1"
FT                   /translation="MQQDHKYKCDVCHSMFRTLEELEEHGRQAHEVSSPDYPCPTCNKK
FT                   FATLEELEKHRKNYHP"
     atgcagcagg accataagta taaatgcgac gtctgtcact ccatgttccg cacactcgaa        60
     gaacttgaag agcacggacg acaagctcat gaggtctcta gtccagacta tccctgccct       120
     acctgcaata agaagtttgc aaccctagag gaactagaga agcatcgcaa gaactaccat       180
     ccgtaa                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page