(data stored in ACNUC7421 zone)

EMBL: CP001825.PE199

CP001825.PE199       Location/Qualifiers
FT   CDS_pept        213495..214469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0201"
FT                   /product="Acetyl xylan esterase"
FT                   /note="PFAM: Acetyl xylan esterase; KEGG: mlo:mlr6993
FT                   acetyl xylan esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41123"
FT                   /db_xref="GOA:D1CDW7"
FT                   /db_xref="InterPro:IPR008391"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR039069"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDW7"
FT                   /inference="protein motif:PFAM:PF05448"
FT                   /protein_id="ACZ41123.1"
FT                   /translation="MPFFDLSLDELQKYLPPRQEPSDFDNFWNNTLQEARAIPINARFE
FT                   PIDFGLRNVETYDVTFKGYGGQDIKGWLLKPKGQNGKIPCVVEFIGYGGGRGFPIDWLT
FT                   WSSAGYIHLVMDTRGQGSSFLKGDTPDDPDAAIDPQFPGFMTRGILSPTTYYYRRVFTD
FT                   AVRAVEVAKQYPDVDSDKIIVTGGSQGGGITLAVAGLVPDVFAAMPDVPFLCHYRRATE
FT                   ITDSAPYIEISKYCAVHRDKVDQVFSTLSYFDGVNFAARAKCPALFSVGLMDEVCPPST
FT                   VFAAYNHYAGPKEIRVYTYNHHEGGGNYQTLEKIKFLHNLLDE"
     atgcccttct ttgatctgtc actagatgag ctacagaaat acttaccacc acgacaagaa        60
     ccttcagact ttgacaattt ttggaataac accctccaag aagccagagc tattcccatc       120
     aacgccaggt ttgagcctat agattttggt ctgcgcaatg tagagactta tgatgtcact       180
     ttcaaaggtt atggtggtca ggatatcaaa gggtggctgc taaagcccaa agggcaaaat       240
     ggaaagatcc cgtgtgttgt ggaatttata ggttatggtg gaggacgagg attccctata       300
     gactggctaa cgtggagcag cgcagggtat atccatctag taatggacac cagagggcaa       360
     ggcagcagtt tcctaaaggg tgatactcca gacgatccag acgctgctat tgatccccag       420
     tttccaggat ttatgacaag aggaatcctt agccctacaa catactacta ccgtagagta       480
     ttcaccgacg ctgtcagagc agtagaggtc gcaaagcaat acccagacgt agactcagat       540
     aagatcatag tcacaggcgg aagccagggc ggaggtataa cgctcgcggt tgcggggcta       600
     gtgccagacg tgtttgctgc gatgcctgat gttccattcc tatgccacta tcgaagagct       660
     actgagatca cagactcagc accctacata gagatctcaa agtactgcgc ggtacacaga       720
     gacaaagtcg atcaggtatt tagcacacta tcttacttcg atggagtcaa ctttgcagca       780
     agagcaaaat gtcctgcact gttctcggtt ggcctaatgg atgaggtctg tccaccgtcc       840
     actgtatttg ctgcttataa ccattatgct ggccctaaag agatcagggt ctatacatac       900
     aaccaccacg aaggtggagg caattatcag actctagaga agattaagtt tctacacaat       960
     ttgcttgacg aataa                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page