(data stored in ACNUC7421 zone)

EMBL: CP001825.PE2

CP001825.PE2         Location/Qualifiers
FT   CDS_pept        1468..2256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0002"
FT                   /product="biotin/acetyl-CoA-carboxylase ligase"
FT                   /note="TIGRFAM: biotin/acetyl-CoA-carboxylase ligase; PFAM:
FT                   biotin/lipoate A/B protein ligase; biotin protein ligase
FT                   domain protein; KEGG: gme:Gmet_1987
FT                   biotin--acetyl-CoA-carboxylase ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40926"
FT                   /db_xref="GOA:D1CDC0"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDC0"
FT                   /inference="protein motif:TFAM:TIGR00121"
FT                   /protein_id="ACZ40926.1"
FT                   /translation="MDQIDLNKLQQILSHTKILREIAFFEEIDSTNSYLKRIINNVDEG
FT                   IVVIADYQSQGRGRRGRTWVSPRGSSISCSILLSPPLTPNRSYILTAACALSIRDSITP
FT                   LVDKPVSIKWPNDVLIGDLKVCGILAESQINSNQTTITTILGFGINVYEYPKSVNATCI
FT                   ADHATTQISRTDLLASILVSLDSRLQVIYSGNWLQVYEEWKDSISTIGQEVTVITDSSN
FT                   IQGIAIGVSKEGGLIIRTPDNELVTVQAGEASIRKPNPKS"
     atggaccaga tagatctcaa taagctccag cagatactat cgcacacaaa aatcctgagg        60
     gagatagcct tcttcgaaga gatagattct actaactcgt acctaaagag gatcatcaac       120
     aacgtagatg agggaatagt agtaatagct gactatcaaa gtcagggtcg aggacgaaga       180
     ggtagaacct gggtttcacc aagagggtct tctataagct gctctattct tctaagtcct       240
     cctttgactc caaacaggtc ctacatacta actgcggcct gtgcgcttag tattcgagac       300
     tccattacgc ccctggtgga taaaccagta agtatcaagt ggccaaacga cgtgctgata       360
     ggcgatctga aagtgtgtgg tatcctggca gagtcacaga taaacagcaa tcagactaca       420
     attactacta tattagggtt tggcattaac gtttacgagt atcctaagtc tgtaaacgca       480
     acctgcatag cagaccacgc cactacccaa atcagcagga cagatctcct agcatctatc       540
     ttggtaagtc tagattcccg tctacaggta atctactcag gaaactggtt acaagtgtat       600
     gaagagtgga aggactctat atccacaata ggtcaggaag taaccgtgat aacggacagc       660
     tctaatatcc aaggaatagc aattggagtc tccaaagaag gagggttgat tataaggaca       720
     ccagacaatg agctcgttac tgtacaagct ggcgaagcct ctattagaaa gccaaaccct       780
     aagagctag                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page