(data stored in ACNUC7421 zone)

EMBL: CP001825.PE200

CP001825.PE200       Location/Qualifiers
FT   CDS_pept        214487..215431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0202"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   swi:Swit_0704 luciferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41124"
FT                   /db_xref="GOA:D1CDW8"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDW8"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ACZ41124.1"
FT                   /translation="MNVIGFGWRFPDFPTDGSSFSDFTQQIRENLDVLVSYNYDSAWVA
FT                   DHFIPWPDWQEEDTPTIECLTTISYYSALYPQIKWGSTVFCQSYRNPAALAKAFAQLCA
FT                   LNPGKYIFGIGAGWKEKEYIEYNFPFPKPSVRITQMAEAIQIAKLLWTQSNATFEGKHY
FT                   RIHEATVNPKPDPLPPIMVGGAGEKLSMRVAAQYADWWNLSGGSIETFRHKLEVLRRHC
FT                   EDVGRSYDSIVKSWSSSCVAVADSSSQAERIARSSPFYSEDSAIFGTPDEVARQVEARI
FT                   SSGVQHFQLRFADFPSTRSMELFGREVIPRFLP"
     ttgaatgtta tagggttcgg atggagattc ccagattttc ctacagatgg tagtagcttc        60
     tctgatttca ctcagcagat acgtgaaaac ctagatgtac tggttagcta caactacgac       120
     agtgcctggg ttgcagacca ttttattccc tggcctgatt ggcaggaaga agatacgccc       180
     actatagaat gtcttactac gatctcctat tactcagcgt tataccctca gatcaagtgg       240
     ggatccaccg tattctgtca atcttacaga aacccagcgg cgctagctaa ggccttcgca       300
     caactctgtg cactcaatcc aggaaaatac atattcggca taggagcggg ctggaaagag       360
     aaggaataca ttgaatacaa ttttcctttt cctaaaccat cagtcaggat aacccaaatg       420
     gcggaagcta tacagattgc caagctattg tggacgcaat ctaatgcaac ttttgagggc       480
     aaacattaca gaatacatga ggctacggtc aaccctaagc ctgacccgct gccaccaatt       540
     atggtaggtg gagctggaga gaaactctct atgagagtag ctgctcagta cgcagactgg       600
     tggaacctat ctggggggag tatagaaacc ttcaggcata aactcgaggt gctacgaaga       660
     cactgtgagg atgttggaag gagttacgac agtatagtaa agagctggtc aagctcctgt       720
     gtggctgtag cagacagctc gagccaggca gagagaatag ccagaagcag ccccttctac       780
     agcgaagaca gcgcgatctt tggtactccc gatgaagtgg ctaggcaggt ggaagcacgc       840
     atatcatccg gagtgcagca ctttcagcta agatttgcag attttccaag caccagaagc       900
     atggaactct ttggtaggga agttatacct cgcttcctac cataa                       945
//

If you have problems or comments...

PBIL Back to PBIL home page