(data stored in ACNUC7421 zone)

EMBL: CP001825.PE201

CP001825.PE201       Location/Qualifiers
FT   CDS_pept        215582..217738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0203"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: ppd:Ppro_0502 response regulator receiver
FT                   modulated diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s); TIGRFAM: diguanylate cyclase; PAS sensor
FT                   protein; PFAM: EAL domain protein; PAS fold-3 domain
FT                   protein; GGDEF domain containing protein; PAS fold domain
FT                   protein; SMART: EAL domain protein; GGDEF domain containing
FT                   protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41125"
FT                   /db_xref="GOA:D1CDW9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDW9"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACZ41125.1"
FT                   /translation="MLQNEVLIIILLAVLGTATILGISASKRTRTSDKESSKLVSATAL
FT                   THLEACLDAANIPMLIIDQNLSISYASKSLQNLINFVPKALIGASLLELIHREDQETAK
FT                   ELILQQNQAHEVSQADVKLRRAGDGWIRVRAYSGRLPSNLILMLIQDVSLTESLRVQLE
FT                   IEHAKIEIAERVANLGLWERDTSTGQEVWSDQTFKIYGLKPGSLEPSYEYLLRIVHPDD
FT                   RDRVDSAYRDSIKALSAYDVSYRILLPDSSIRVVHSKAQIVKGADSHLLLTGTVQDVTE
FT                   QKVNEESLLRQALHDPLTGLPNRVMLGQQLEKLLASNRSRSIAVLFLDLDNFKAVNDNL
FT                   GHQAGDSLLVAVARRLSANLRPTDFAARFGGDEFTVVVTKVKSIDYVVSIAKRIIESIS
FT                   QPFDIAGERVYTSTSIGIALCSSSEDSASSLLRKADIALYKSKSLGRGTYVIFDQSMEQ
FT                   EASEILELERNLRTAIQNDQFIVHYQPIVDAATGKVEMIEALLRWNSPNGILSPDKFIP
FT                   IAEEVGLINTLGELVLNKACEQTAYLKATTGAKFITSINVSAKQLRQPHFTNNLESMLH
FT                   KYDLQPKDVQLEITENALVEEVECITNALKEIKTLGIRIAIDDFGTGYSSLSYLRKLPI
FT                   DLIKIDQSFVKMLPNDEEHRAIIYTIISLACSLDLEIIAEGVEEKSQREILLSMGCKFI
FT                   QGNLISHPVDLESIKLILGHTSPK"
     atgttacaga atgaagtact gattataatc ctgctggcag tattaggaac agccacaata        60
     ttaggtatat cagcaagcaa gagaacgagg acctcggata aagagagctc aaagctggta       120
     tcagcaactg ccttaactca cttagaagca tgcctagatg cagcaaatat acccatgttg       180
     ataatagatc agaacctcag catatcttat gctagtaaat cgttacaaaa cttgatcaac       240
     ttcgtcccca aagccttaat aggggcaagt ttattagagc taatccacag ggaggatcaa       300
     gaaaccgcta aggagctaat acttcagcag aatcaagctc atgaggtttc acaggctgac       360
     gtaaaactac gtagggccgg agatggctgg attagggtta gagcttactc cggcaggctg       420
     ccttccaatc ttatattgat gctaatacag gatgtctcgc taacagaatc tctaagagtg       480
     cagctagaaa tcgagcatgc aaagatagag atagcagaaa gagttgcaaa cctgggacta       540
     tgggaaagag atacatctac gggtcaagag gtatggtccg atcagacctt caagatttat       600
     ggactcaaac ccggatccct ggagccaagc tatgagtatc tacttagaat agtacatccg       660
     gatgacaggg atcgtgtcga tagtgcctat agggactcta taaaggcttt aagcgcatac       720
     gacgtttctt acagaatact acttccagac agcagtataa gagtagtaca cagtaaagct       780
     caaatagtaa aaggggctga ttcacacctg ctacttacag gcacggttca ggatgtgacc       840
     gagcagaagg tgaacgaaga gagtttactt aggcaagctc tccatgaccc attaactggt       900
     cttccaaaca gggtaatgct agggcagcaa ctcgagaagc tccttgcctc caacagaagc       960
     cgcagcattg ccgtcttgtt tctggaccta gataacttta aagcagtaaa tgacaacctg      1020
     ggacaccaag caggagattc tctgttagtt gcagtcgccc gcaggctcag tgctaaccta      1080
     cgcccaaccg actttgcagc gcgatttgga ggggatgaat tcactgtagt ggttacaaag      1140
     gtgaagagca tcgactatgt cgtatcaata gcaaagcgga tcatcgaatc catcagtcag      1200
     ccatttgata tagctgggga acgcgtatat acatccacca gcatagggat agcactatgc      1260
     tcctcttcag aagattccgc ctcatcacta ctaagaaaag ctgatattgc tttgtacaag      1320
     tcaaagtcac tgggaagagg cacttatgtc atctttgatc aatccatgga acaggaagcc      1380
     tcagagatac tggaactaga gcgcaacttg agaacggcca tacaaaacga ccagttcata      1440
     gtgcattatc agcccatagt ggacgctgcc acaggcaagg tagaaatgat agaagctttg      1500
     ctcaggtgga attctcccaa tgggatttta agtcccgaca agtttatccc catcgctgag      1560
     gaagttggat taatcaacac actaggagaa ttagtgctta ataaagcatg tgagcagact      1620
     gcatatttga aagcaactac cggagctaag ttcataacaa gtataaacgt atctgcaaaa      1680
     caacttaggc aacctcactt cactaacaat ctagaatcta tgcttcacaa gtatgactta      1740
     cagccaaaag atgtacagtt ggaaatcacc gaaaacgcac tggtagaaga ggtagaatgc      1800
     ataacgaacg cgcttaaaga aatcaagact ctaggaataa ggatagcaat agatgatttc      1860
     gggactgggt attcaagcct aagctatctc agaaaattgc caattgatct catcaagata      1920
     gatcaatcat tcgtcaaaat gctacctaat gatgaggaac atagagcaat aatttacaca      1980
     attatctcct tagcttgctc ccttgacctg gaaataatcg cggaaggcgt agaggaaaag      2040
     tcacagaggg agatcttatt atccatgggc tgcaagttca tacagggaaa tctaatatct      2100
     cacccagttg acctagagag catcaagcta atattaggcc acacatcccc caagtga         2157
//

If you have problems or comments...

PBIL Back to PBIL home page