(data stored in ACNUC7421 zone)

EMBL: CP001825.PE204

CP001825.PE204       Location/Qualifiers
FT   CDS_pept        complement(220361..221206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0206"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bha:BH3847 ABC transporter
FT                   (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41128"
FT                   /db_xref="GOA:D1CDX2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDX2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ41128.1"
FT                   /translation="MSTKPMQLPRIRYSRIIIYLVMIAFAVFYLLPVYLMLITGMKSFE
FT                   EVSISRMWALPSSLSFDSFAAAWERLDVSFLNSIKLVIPATVISSVLGSMNGYVLSKWK
FT                   FKGADTIFTAILFGMFIPYQSILIPLVLTLQKIGLYGSIPGLILTHVVYGIPITTLIFR
FT                   NYYAGIPGELVEAGKVDGAGFFGIYRHIIFPLSVTGFVVVAIWQFTSIWNEFLFGLIIT
FT                   NSPEQRPVTVALQNIAGSQYTLWNVQMAGALLVAIPTLVVYVLLGRYFLRGLLSGALKG
FT                   "
     atgagtacca agcctatgca gttgccaaga attagatatt cgcggatcat catctacctg        60
     gtcatgattg catttgcggt tttctacctg ttgccagtgt atttgatgct tatcaccgga       120
     atgaaaagct ttgaggaagt tagcataagc cgtatgtggg ctctgccatc ttcccttagc       180
     tttgatagct ttgctgccgc ttgggaacgg cttgatgtaa gcttcctaaa cagcataaag       240
     ctcgttatac ctgcaactgt catctccagc gtcttgggct ccatgaatgg ctatgtgctt       300
     tctaagtgga aattcaaggg agcagatact atatttacgg ccatactttt cggaatgttt       360
     attccttacc agagcatact aatacccttg gtcctaacac ttcagaagat aggactttat       420
     ggctccatcc ctggattgat acttacccat gtggtgtatg gaataccgat cactacgcta       480
     atatttcgta actactatgc gggtatacct ggagagctgg ttgaggctgg caaggtggat       540
     ggtgcgggat ttttcggcat atatcgacat atcatattcc cgctatccgt cactggcttc       600
     gtagtggtgg cgatatggca gttcacatct atatggaatg agttcctgtt tgggttaata       660
     atcactaatt ctccagagca acggcctgtg accgtagctt tgcagaatat agcaggaagt       720
     caatatacgc tctggaacgt acagatggca ggggctctac ttgtagctat tcctactctg       780
     gtggtctatg tacttctagg acgttacttc ctgagaggtc tgctatcagg tgccctgaag       840
     gggtga                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page