(data stored in ACNUC7421 zone)

EMBL: CP001825.PE207

CP001825.PE207       Location/Qualifiers
FT   CDS_pept        complement(223851..224792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0209"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbd:CBUD_1719 hypothetical peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41131"
FT                   /db_xref="GOA:D1CDX5"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDX5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41131.1"
FT                   /translation="MSSIEDTRLFLRSLNLPPGDLYDLPTSTKRFPDGAQYRIEIPSTE
FT                   GPACLHAVIEEAERLGVTIHRVSQGSGVLMLTDDEIDEMASLASAKGMEVSLFARPNAS
FT                   WDTSAMSLASAGGVVSPRARGQDQLIYCLEDIRRAADHGIRSVLLADEGVLWVAAKMRS
FT                   GGELPADMQFKMSVMMASANPASIRLMQDLGADTYNIPTDLTLPQIASIRAAVDIPLDI
FT                   YVEVPDDVGGFVRLYEIPELIRIASPVYIKLGLRNAPNIYPVGKHLESVAVLMSRERVR
FT                   RAKIAVDIIQRYYPDAVQSAAGAKGLAVPRKP"
     atgagctcca tcgaggatac acgactgttc ctgagaagtc taaatttgcc tccaggtgac        60
     ctttacgatc ttcctactag cactaagagg ttccctgatg gagcacaata tagaattgag       120
     attccaagca cagagggccc tgcgtgtttg catgcagtaa tagaggaggc tgagcgtctt       180
     ggagtaacca tacatagggt atctcagggt agcggggttc taatgctaac agatgatgag       240
     atagatgaga tggcctcatt ggcttctgcc aaaggtatgg aggtgagcct atttgccagg       300
     cctaacgcga gctgggatac tagtgccatg agtcttgcta gcgcaggtgg tgtagtgtct       360
     ccacgtgcgc gaggtcagga tcagctcatc tattgtctag aggatatcag gagggctgca       420
     gaccatggga taaggagtgt cctgttggct gatgaaggtg tgctgtgggt cgcagccaaa       480
     atgcgctctg gaggagaact cccagcagat atgcagttta agatgagtgt gatgatggct       540
     tcagccaatc cagcatcaat ccgtcttatg caggatctag gagctgatac ctataatatc       600
     cccacagact tgacccttcc tcagatagca agtatacgtg cagccgtgga tataccgctt       660
     gatatatatg tggaggtacc tgatgatgtg ggaggctttg tcaggttgta tgagattcct       720
     gagttgataa ggatcgcgtc tccggtttat atcaagctgg gattaagaaa tgccccaaat       780
     atatatcccg taggcaagca tctggaatcc gtagctgttc taatgagcag ggaaagggtg       840
     agaagagcca agatagctgt agatataata cagcggtact atccagatgc cgtgcaatct       900
     gctgcaggag ccaagggatt ggcggtacct agaaaaccct aa                          942
//

If you have problems or comments...

PBIL Back to PBIL home page