(data stored in ACNUC7421 zone)

EMBL: CP001825.PE21

CP001825.PE21        Location/Qualifiers
FT   CDS_pept        complement(22871..23338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0022"
FT                   /product="cyclase/dehydrase"
FT                   /note="PFAM: cyclase/dehydrase; KEGG: sgl:SG1803
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40945"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDD9"
FT                   /inference="protein motif:PFAM:PF03364"
FT                   /protein_id="ACZ40945.1"
FT                   /translation="MQATNSIFIKAPPEKIMDLVGNVQRWQEYLPHYRYVRALGDDGSV
FT                   RTFEMGASRSGIPVSWVAEFQAFPESHKLRFTHVGGITKGMYVEWRLMPSKGGTNVEIY
FT                   HDLRLRWPPVFRQIGELVITKLFIEHIASRTLRRFKELAESSEERHSQNEN"
     atgcaagcaa ctaacagcat atttatcaaa gcacccccag agaagataat ggatttggtg        60
     ggtaatgttc agcggtggca ggagtattta ccgcattaca ggtatgtaag agctcttgga       120
     gatgatggaa gcgttagaac ttttgagatg ggggcttcca gaagtggcat acctgtatca       180
     tgggtggctg agtttcaagc tttccctgag tcccataaac tcaggtttac ccatgtaggg       240
     ggtatcacca aggggatgta cgtggagtgg cgtttgatgc cgtcaaaagg aggcactaac       300
     gtggagattt accacgacct gcgactaagg tggccgccgg tgtttaggca gatcggtgag       360
     ttggtcataa ccaagttatt tatagagcat atagcttcca ggactttgag aagatttaag       420
     gaacttgccg agtcgagcga agaaaggcat agccagaatg aaaactga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page