(data stored in ACNUC7421 zone)

EMBL: CP001825.PE211

CP001825.PE211       Location/Qualifiers
FT   CDS_pept        complement(229685..230224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0213"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afw:Anae109_3322 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41135"
FT                   /db_xref="GOA:D1CDX9"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDX9"
FT                   /inference="similar to AA sequence:KEGG:Anae109_3322"
FT                   /protein_id="ACZ41135.1"
FT                   /translation="MLILARNWWSLVLRGVIAILFGILAFIWPGITVLVFVALFAAYAI
FT                   IDGILAIISAFRDSRNWLALVIEGVLGLAAGIVAILWPGITALALLYLIAAWAVVTGIF
FT                   EIAAAIRLRREISNEWLLGLAGLLSIVFGIILFLFPGSGALAVVWIIASYAILFGILLI
FT                   ALGLRLRSLYNSLRAA"
     atgttgatcc tggccaggaa ctggtggtct cttgttctaa gaggtgtcat tgctattcta        60
     tttgggatat tagcctttat ttggcctggt ataacagtgc tagtgtttgt tgccttgttt       120
     gctgcttatg ccatcataga tggtatcctg gctatcatct cggcgtttcg tgactctaga       180
     aattggctag ctcttgtaat agaaggtgtt ttgggattag cggctggtat agttgctatc       240
     ttatggcctg ggataacagc tttggctctg ctttatctta tagcagcttg ggcagtggtc       300
     acaggtatat ttgagatagc agctgcgata cgccttcgta gagagatttc caatgaatgg       360
     ttgcttgggt tagctggact gctctctata gtttttggga taatcctctt cttattccct       420
     ggttctggtg cactggcggt ggtctggatt atagcctcgt atgcgatact gttcggcata       480
     ctgctgatag cgctaggact aagacttagg agtctttaca attctctgcg agcggcttag       540
//

If you have problems or comments...

PBIL Back to PBIL home page