(data stored in ACNUC7421 zone)

EMBL: CP001825.PE217

CP001825.PE217       Location/Qualifiers
FT   CDS_pept        complement(235372..237402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0219"
FT                   /product="4-amino-4-deoxy-L-arabinose transferase-like
FT                   protein glycosyltransferase of PMT family"
FT                   /note="KEGG: nmu:Nmul_A0278 glycosyl transferase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41141"
FT                   /db_xref="GOA:D1CDY5"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDY5"
FT                   /inference="protein motif:COG:COG1807"
FT                   /protein_id="ACZ41141.1"
FT                   /translation="MLWFAHSWRVPPDASWYLLHGLNIISGKGYVDIQGDPQVVRGPVF
FT                   PAFLGFIMLLLGKNIDQLAWAVRLFALLNPLLLYLLIKRLLGTREALVAALFLAYFGYT
FT                   STLSQAFNIDAFLLTEYLLTAYLVLTAVDRRSSWLSLLSGFMLGLMILTKETSIVVLPT
FT                   AVVAALLLGWTLKDVLLHYLGVLVICAPWWVWVWNVSQSVFLLGKVPVYFLYLVVAVSL
FT                   IAVMVFYLAYRLGVFHKLAIYLQANRERCAWVLVIGWTLVASLAMLSQVNDLRVDQSTA
FT                   KYLVNQVMRGTPLWYVLPLGGLFAIWKSIKGSRNWAYLLAMGILWVPVSLVALVMEISI
FT                   RQWMIQQALGYASLAGLYIAAPEFFSRLKDWDWKIVLKGIPSRSQVIAFVSSHYLLNYA
FT                   LTCVLILFLIWGTGVQTRILANGIASNTANDNPVATDINPAVLDMKNWIDQNIPKGETI
FT                   LATWQYSYQLAFQDDFKHKWKAFKMNCASGPESISASSCRLDIQVTPVWPPTQIPFWMH
FT                   MDNACRPTMVTFSDLIREMKKDEASYLLMTRQQDFTATNSWTPALVSSGAFELMYQTFV
FT                   RRGSPSNQISLSMLRITGREPRNLPTQMSAESVINLAQCERRRVGEDKYVQSIRSILPY
FT                   GIWLVSDPNDNTAYSAEREREAREIIESIYGYLPKMPSQNS"
     ttgctctggt ttgcccactc ctggagggta ccgcctgatg cttcctggta cttgctacac        60
     ggactgaata tcataagtgg taaggggtat gtagatatcc agggtgaccc acaagtcgtt       120
     cgtggccctg tgtttcctgc ttttttgggc ttcatcatgc ttctgctggg caagaatata       180
     gaccagctgg cttgggcagt gagattgttt gcgctgctga atcccctgct tctctatctt       240
     ttgataaaga ggctgcttgg gactagagag gcgttagtgg ctgctctctt cctagcttac       300
     tttgggtata caagtacttt atctcaggct ttcaacatag atgccttcct tcttactgag       360
     tacctgctca ccgcctattt ggtactgact gctgttgatc gcagatctag ctggttaagt       420
     ctgctttcgg gctttatgct cggactgatg atccttacta aggaaaccag catagtggtt       480
     ctccctacag ctgtagtagc cgcccttctt ctggggtgga ctctaaaaga tgtgttgctg       540
     cactacttgg gagtgctagt tatatgtgcc ccttggtggg tgtgggtgtg gaatgtaagt       600
     caaagcgtgt tcctgttagg taaggttcca gtctactttc tatatctagt ggtagcggta       660
     tctctaattg ccgttatggt attctacttg gcttacagat tgggggtgtt tcataagcta       720
     gcgatatatt tgcaagctaa tagggaaaga tgcgcctggg ttcttgtaat tggatggacg       780
     cttgtagctt ctctagccat gttatcccag gtgaacgact tgagagtaga tcagtctact       840
     gcaaagtatc ttgtcaacca ggtaatgcgt ggtacgcctc tgtggtatgt ccttccacta       900
     ggtgggttgt tcgccatatg gaagtccata aagggcagca gaaactgggc atatttgctt       960
     gcaatgggga ttctatgggt gccggtttct ctggttgctc ttgtgatgga gatatccatc      1020
     aggcagtgga tgatccagca agcattaggt tatgcttccc tagccggcct gtacatagct      1080
     gctccagaat tcttttccag actaaaggat tgggactgga agatagtcct gaaaggtata      1140
     ccttctagat cacaggtcat agctttcgtg agttcgcatt acctactcaa ctatgctctt      1200
     acctgcgtac ttatactttt ccttatatgg ggaaccggag tacaaaccag gattctggca      1260
     aatggcatag cttctaatac tgctaatgac aatccagtgg ccaccgatat aaatcctgcc      1320
     gtgttggata tgaagaattg gattgatcag aacatcccca agggggaaac catacttgcg      1380
     acctggcagt actcatatca gctagctttc caggatgact tcaagcataa gtggaaagct      1440
     ttcaagatga actgtgcttc tggcccggag tctatatctg catcttcatg cagattggat      1500
     atacaggtaa ctcctgtctg gccgccgaca caaataccct tctggatgca tatggataat      1560
     gcctgcaggc caaccatggt cactttctct gatttgatca gggagatgaa gaaggatgaa      1620
     gcttcttatc ttcttatgac gaggcaacag gattttacgg caactaactc ttggactcca      1680
     gcattagttt caagtggagc ttttgagctg atgtatcaga cctttgttag aagagggtct      1740
     ccatccaacc agatatcgct ttctatgctg aggataacgg gtagagaacc tagaaatctg      1800
     ccaacgcaga tgagtgcgga gagcgttata aatctagctc aatgcgaaag gcggagagta      1860
     ggtgaggaca agtacgtaca gtccatcagg tctatactcc cttatggtat atggcttgta      1920
     agtgatccca atgacaacac tgcttattca gctgaacgtg agagggaagc gagggagatc      1980
     atagagtcta tatatggcta tctgcctaag atgccgtcac aaaacagcta g               2031
//

If you have problems or comments...

PBIL Back to PBIL home page