(data stored in ACNUC7421 zone)

EMBL: CP001825.PE22

CP001825.PE22        Location/Qualifiers
FT   CDS_pept        complement(23367..24563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0023"
FT                   /product="geranylgeranyl reductase"
FT                   /note="TIGRFAM: geranylgeranyl reductase; PFAM:
FT                   monooxygenase FAD-binding; KEGG: psb:Psyr_0428
FT                   monooxygenase, FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40946"
FT                   /db_xref="GOA:D1CDE0"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDE0"
FT                   /inference="protein motif:TFAM:TIGR02032"
FT                   /protein_id="ACZ40946.1"
FT                   /translation="MIEEREVVIVGGGPAGSSVANVLASLGHDVLLLDKSRFPRPKPCS
FT                   EYMSPGILPLLSNLGIDADLSGMHMLKGMRIHTPAGSQITIEYVDEHNGRYYAPTMERH
FT                   VFDKMLLDHAAHKGVEVRYQAKVMSVVSQDNYSILRVQLPDRAQMDIRTKLVIGADGLR
FT                   SVVARNLSRRYPLIWPKRMGLVTHINLPGIDADYGDMYVHPWGYCGVAATGKSSASVGI
FT                   VLDLRRMALTRGREAIFEDSLKLFPKAHKQICGAASFDRIMGISPIGHGVKEVHGRNWA
FT                   LVGDAAGFFDPFTGEGIYKAVRGGILLGEVVSPYLKVGRIKEGLERYATERARVFRRKS
FT                   LLVSLIQIFISYPYMLEYVANKLQDREALRLSLSRGIGDLQDPLYNLNLRFLFGLLRP"
     gtgatagagg aacgagaagt agttattgtt gggggtgggc ctgcagggtc ctcggtcgcg        60
     aacgtattag cttctcttgg gcatgacgtg ttgctcctgg ataagtctag attccctaga       120
     ccaaagccct gtagcgaata catgagccct ggaatccttc ctttgctctc gaatcttggg       180
     atagacgctg atctctcggg gatgcacatg ctaaagggta tgaggataca cacccctgca       240
     ggaagccaga taactattga gtacgtggat gagcataatg gaaggtatta tgcccccact       300
     atggagaggc atgttttcga taagatgctc cttgatcatg ctgctcataa gggtgtagag       360
     gttagatatc aggccaaagt gatgtcagtt gtatcccaag ataattattc catccttagg       420
     gtgcaacttc cggacagagc gcagatggat ataagaacca agctggtgat aggagcagat       480
     ggtctcaggt cagtggtggc gcgtaatttg tccaggagat atcctctcat ctggcccaaa       540
     cgaatgggac ttgttactca tatcaacctt ccagggatag atgcagacta tggagatatg       600
     tatgtgcatc catgggggta ctgtggtgtg gcggcaactg gtaagtcaag tgctagcgtg       660
     gggatagtgc ttgacttgag acggatggcg cttacgcgtg gtagagaagc catttttgag       720
     gattctctca agctttttcc taaggcccat aagcagatat gtggagctgc tagctttgat       780
     cgtatcatgg gcatatcgcc tattggacac ggagtcaaag aagtacatgg tcgtaattgg       840
     gcgctagtag gtgatgcagc agggttcttt gatcctttca ctggggaggg aatatacaaa       900
     gctgttaggg gtgggatctt gttgggggag gtagtatccc cttacctaaa ggttggcagg       960
     attaaagaag gtctggaaag gtatgcgact gaaagggcac gtgtttttcg gcgcaagtct      1020
     ttgcttgtat ctctgataca gatctttatt tcctatcctt atatgctgga gtatgtagcg      1080
     aataagctgc aggatagaga agcgcttcgc ttgtcactta gtcgtggtat tggagatcta      1140
     caagatccac tgtacaatct gaatctcagg tttctcttcg gattgctccg accttga         1197
//

If you have problems or comments...

PBIL Back to PBIL home page