(data stored in ACNUC7421 zone)

EMBL: CP001825.PE220

CP001825.PE220       Location/Qualifiers
FT   CDS_pept        240175..241359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0222"
FT                   /product="peptidase M50"
FT                   /note="PFAM: peptidase M50; CBS domain containing protein;
FT                   SMART: CBS domain containing protein; KEGG: noc:Noc_1011
FT                   peptidase M50"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41144"
FT                   /db_xref="GOA:D1CDY8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR016483"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDY8"
FT                   /inference="protein motif:PFAM:PF02163"
FT                   /protein_id="ACZ41144.1"
FT                   /translation="MLGPGIPIGRIFGIRIYIDPSWIFIFLLVTWNLAAGALAVVHPEW
FT                   GTTTIWLVAIAASLLFFGSVLAHELAHSLVARSQGVPVRRITLFMFGGVADIEREPPSP
FT                   RAEFLITVVGPLTSLVLGIVFLVIGTAIAGISNLSIYNPEGLLAQLNPLSTIFLWLGPI
FT                   NIVLAVFNLVPGFPLDGGRILRSIIWAISNNLRLATRIASFIGQAIGWLMILAGVAMIF
FT                   GAHIPFFGTGLVSGLWLIFIGWFLSSAASQSYRQLVIHHILEGVPVNRIMRTDIPTASP
FT                   YMTIEDLVRLLLINSDERSFPVVEEDRLVGLVCIEDLKKVAREEWPIVPVSRIMTPRDK
FT                   LITIGPNDDLAKAFEQLARIDVNQLPVVVGDTLVGLLRRRDLLRWLQIHSQIAR"
     atgctagggc caggaatacc gataggtcgt atattcggta taaggatcta tatagatcct        60
     agctggatat tcatctttct acttgtcact tggaacttag cagccggtgc attagctgtc       120
     gtacatcctg aatggggcac taccactata tggttagtgg caattgcagc ttctttgctg       180
     ttttttggat cggtgcttgc tcacgagctt gcgcactccc tcgttgcgag atctcaagga       240
     gtccctgtcc gaagaataac cctcttcatg ttcggtggag tagcagatat agaaagagag       300
     ccaccatccc ctagagctga attcctgatt acggtagtgg gaccattaac aagcctggta       360
     ctaggtatcg tattcctggt gataggcaca gcaatagcag gtatatcgaa cctgtcgata       420
     tataatccgg aaggcttgct ggcccagctt aatcctctat caaccatatt cctatggcta       480
     ggccctataa acatagtgct tgctgtgttc aatttagtcc caggctttcc attggatgga       540
     gggaggatac taagatccat catctgggcc atatctaaca acttaagact agctacaaga       600
     attgcgtcat tcataggtca agcaattgga tggctaatga tattggcggg cgtagcgatg       660
     atatttgggg ctcacatacc atttttcggg acaggactgg ttagtggttt atggttgatc       720
     tttatagggt ggtttcttag cagtgcggca tctcaaagct ataggcagct ggtcatacac       780
     catatattag aaggcgtacc agttaacagg atcatgcgga cggacatccc cacggcaagt       840
     ccctatatga ccatagaaga tctcgtgagg cttctgctta tcaactcaga tgaaagatcg       900
     ttcccagtag ttgaggagga caggctcgta ggactagtat gcatcgaaga tctgaagaaa       960
     gtggctaggg aagaatggcc tatagttccc gtaagtcgaa tcatgactcc cagggataag      1020
     ttgataacta tagggcctaa tgatgatcta gccaaggcct ttgagcaact tgcaagaatc      1080
     gacgtcaacc aacttccagt ggttgttggt gatacccttg tgggactact acgtaggcgc      1140
     gacctactac gatggttaca gatacattct caaatagcca ggtaa                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page