(data stored in ACNUC7421 zone)

EMBL: CP001825.PE221

CP001825.PE221       Location/Qualifiers
FT   CDS_pept        complement(241364..242695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0223"
FT                   /product="UDP-N-acetylglucosamine1-carboxyvinyltransferase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine 1-
FT                   carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1- carboxyvinyltransferase); KEGG:
FT                   mgm:Mmc1_1221 UDP-N-acetylglucosamine 1-
FT                   carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41145"
FT                   /db_xref="GOA:D1CDY9"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDY9"
FT                   /inference="protein motif:TFAM:TIGR01072"
FT                   /protein_id="ACZ41145.1"
FT                   /translation="MHTLLIEGGVPLRGEVRIAGAKNAALKMMAAALLTEEEVHLSNVP
FT                   HISDVYVMSALLQTLGVEVNWNGPNTLRIRAKDIRPVRFGIDVAAKIRASFVVMAPLLA
FT                   RCGEASVPNPGGDRIGHRPVDRLVEGLRHFGVCIDYDGAYYNATCDRLRGCEYRFNKNS
FT                   HMGTEHQIMAAVLAEGRSVIYNAAQEPEVDDLIDMLNSMGARIKRVEPRTIVIDGVRKL
FT                   GGTHHTVMPDRIEAGTFAIMAAATDGDLYLSGANPDHMQALLDKMKEAGCRIEADPEGI
FT                   RVRRGESLRAVNVITRPHPGFMTDWQAPFVVLLTQASGVSLVHETIFPNRLGYTEQLNL
FT                   MGAHIELFNPPVPDCGYEWNEKDDSPDYFHAARIYGPTPLRAANLTIPDLRAGATLIIA
FT                   ALCAEGVSKVSGVQWVERGYEHFVERLRSLGARIEESLPAEATA"
     ttgcacacgc tactgataga agggggagta ccccttagag gagaggttag gatagcaggg        60
     gctaagaatg ctgctcttaa gatgatggca gctgctttgc taactgagga ggaggtacat       120
     ctttctaatg tgcctcatat cagcgacgta tacgtcatgt cagctctact tcagacgtta       180
     ggggtagagg tgaattggaa tggccctaat actctcagga tcagagctaa ggatattcga       240
     cctgttaggt ttggtattga cgtggccgct aaaataaggg cttcatttgt ggtaatggcg       300
     cccttgctgg ctagatgtgg agaagctagt gtgcctaatc caggaggcga caggatcggg       360
     catagaccgg ttgatagact tgtagaagga cttaggcact ttggtgtttg tatagattat       420
     gatggtgctt attacaacgc tacttgtgat aggttgaggg gatgcgagta cagatttaac       480
     aagaactcgc atatgggtac agagcaccag ataatggcag ctgtgctggc tgaaggaaga       540
     tcagttatat acaatgccgc gcaagagcca gaagttgatg acctgataga tatgctgaac       600
     tctatgggtg ccagaataaa gcgagttgaa cctaggacaa tagtcataga tggagtacgc       660
     aaactcggtg gtactcatca cacggtaatg ccggatcgga tagaggctgg gaccttcgca       720
     ataatggcgg cggctacaga tggcgatctg tacctgtcag gagctaaccc cgatcatatg       780
     caggctttac ttgacaagat gaaagaagct gggtgcagga ttgaggcaga cccggaaggt       840
     attcgcgtac gtcgaggtga gagccttcga gcagttaatg taatcacaag gcctcatcct       900
     gggtttatga ccgattggca agctcccttt gttgtcctcc tgactcaggc aagtggagtc       960
     agtttagtac atgagactat attccccaac aggcttggat atacagaaca gctaaacctt      1020
     atgggggctc acatagagtt atttaatcct ccggtgcctg attgcggtta tgagtggaat      1080
     gaaaaggatg attctccaga ctattttcac gcagctcgaa tctatggccc tacccctcta      1140
     agggctgcta atcttaccat acctgacctt agggctggtg caacacttat catagcggct      1200
     ctgtgtgctg agggggtaag taaagtcagt ggtgtgcagt gggtagagcg tggctatgag      1260
     cacttcgtgg agaggcttag atctctaggt gcgcgtatag aggagagtct acctgcagaa      1320
     gcaacagcct aa                                                          1332
//

If you have problems or comments...

PBIL Back to PBIL home page