(data stored in ACNUC7421 zone)

EMBL: CP001825.PE223

CP001825.PE223       Location/Qualifiers
FT   CDS_pept        complement(243118..243513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41147"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDZ1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41147.1"
FT                   /translation="MSTRWSEKDLYLLGSSASVDIKLVSELSPDESRHVIRGLWDSRGF
FT                   IGLNLGGYPVTSLVVDSLDLAFWISEYIRAVVGRYIPPRNLKSGLIWVGVSGRKCLPWL
FT                   RYIYDQSNFVSADKFSKAKELISILEQ"
     atgtccacac gttggagcga gaaagattta tacctcttgg gtagttctgc gtctgtcgac        60
     ataaagctgg tgtctgagtt atctcctgac gaatctaggc acgttataag agggctatgg       120
     gacagtaggg gatttattgg cctaaatcta ggaggctatc ctgtaaccag cttggtggtg       180
     gatagcctgg atttggcttt ctggatatct gagtatattc gggcagttgt gggcagatat       240
     atacctccca ggaatctgaa atcagggctc atatgggttg gtgtttcggg caggaaatgc       300
     ctcccttggc ttcgatatat ctatgatcag tctaattttg tctcggcaga taagttttct       360
     aaggctaaag agcttattag catattagag caatga                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page