(data stored in ACNUC7421 zone)

EMBL: CP001825.PE226

CP001825.PE226       Location/Qualifiers
FT   CDS_pept        complement(245642..246703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0228"
FT                   /product="Threonine aldolase"
FT                   /EC_number="4.1.2.5"
FT                   /note="PFAM: aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase; aminotransferase class I and II;
FT                   KEGG: sfu:Sfum_0699 threonine aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41150"
FT                   /db_xref="GOA:D1CDZ4"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR023603"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDZ4"
FT                   /inference="protein motif:PRIAM:4.1.2.5"
FT                   /protein_id="ACZ41150.1"
FT                   /translation="MHVIDLRSDTVTLPTEEMRKAMAEAEVGDDQSREDPTVNKLEELA
FT                   AEIIGKEAALFVPSGVMGNLCAMLVHCERGQEVIMGDQSHILWYESGSGAALGGLVYRS
FT                   VHNGRFGELNPSEVEETIRPERLGFPRTGLVCLENTHNRCGGTVLNLQQIEGIVDVAHR
FT                   HNVPVHMDGARIFNAAIYLGVPAKELAKPVDSIEFCLSKGLSAPVGSIVAGSEGFVREA
FT                   RRVRKLLGGAMRQSGVIAAAGIVALEKMIDRLHEDHVNARKIAEGIVDLDGIRLDLETV
FT                   QTNIVAFDLVSPDWTPPKLISELESRGLRISSYGGRKMRIVTHYGISDDEYDQAIKIFR
FT                   DVLTGTYVSYPQH"
     atgcatgtaa tagaccttag gagtgataca gtcactctac ccacagaaga gatgcggaag        60
     gccatggcgg aagccgaagt cggcgatgat cagagcagag aagaccctac ggtcaacaag       120
     ttggaggagt tagctgctga gatcataggt aaggaagcag ctttatttgt acctagcggc       180
     gttatgggta acctatgtgc aatgctagtg cactgcgaga ggggacaaga agtgataatg       240
     ggagatcaat cccatatcct ctggtacgaa agtggtagtg gggctgccct agggggatta       300
     gtatatcgat cggtgcacaa cggcaggttc ggagagctaa atccatctga ggtagaggaa       360
     actatacgcc ccgaacgact gggcttccct agaactgggc ttgtgtgtct tgagaacaca       420
     cataacaggt gtggagggac ggtactcaac ttgcaacaga tagagggtat agtcgatgta       480
     gctcatagac ataatgtgcc tgtacatatg gatggtgcca ggatattcaa tgctgctatc       540
     tatttgggag tccctgcaaa ggagttggca aagcctgtag atagcataga gttctgcctt       600
     tctaaaggat tgtcagcgcc agttggaagt attgtggcag gtagtgaggg ctttgtaaga       660
     gaggccagaa gagtaagaaa acttcttgga ggagcgatgc gccagtcagg agttatagcc       720
     gctgcaggta tagtcgctct ggagaaaatg atagaccgtc ttcatgagga ccatgtaaat       780
     gcccgtaaaa tcgctgaagg tatagtagat cttgacggta tacgcctgga tctagaaacg       840
     gtacagacta acatagtggc ttttgatctt gtatcgcctg actggactcc ccctaagctt       900
     atttctgaac tggaaagccg agggttgcgt ataagcagct atggtgggag aaagatgcgt       960
     atagtgactc attacggaat cagtgatgat gagtacgatc aagctataaa gatatttcgt      1020
     gatgttctaa ctgggaccta tgtttcttat cctcaacact ga                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page