(data stored in ACNUC7421 zone)

EMBL: CP001825.PE227

CP001825.PE227       Location/Qualifiers
FT   CDS_pept        246864..248039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0229"
FT                   /product="NMT1/THI5 like domain protein"
FT                   /note="PFAM: NMT1/THI5 like domain protein; SMART:
FT                   extracellular solute-binding protein family 3; KEGG:
FT                   rpd:RPD_2108 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41151"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDZ5"
FT                   /inference="protein motif:PFAM:PF09084"
FT                   /protein_id="ACZ41151.1"
FT                   /translation="MSDCCNRNIMERDICPCDGIDLLDDSQTAPEIQTHPITRRQVLKY
FT                   MGGFLLTGFIAACGQAGGPQAQKSPVPTSIVSSQPTAPSREGLTKLDLAFCSQVLCILP
FT                   FEVARQQGYFADEGYDVNLIYMKGGALAINALISKSVDFVGTPMDLIVRSVDQGQPVIM
FT                   VASTSRLPFFALVVSPGKSSEITKISDLQGKRVGVNNLGTTDDLLLKALLAKNNLDPNS
FT                   TDSVALGPNLYDALLRGEVDAGMVQEPALTLLSQKGARVLVNFMDRQQTNEVLGGDYQF
FT                   MGLNTRPDVLDSKPDVVEKLARALVKANQWILNHTGSEIVKAAPQELAPGDDIQIFAKA
FT                   LDKYKESLYPSDGVIEEHAVRRVVETQKISGLLKNENIDISTLYTNKYVEG"
     atgtctgatt gttgcaacag aaatattatg gagagggata tttgcccctg tgatggtata        60
     gatctactag atgattctca aaccgctccc gaaattcaaa ctcatccaat aactcgtaga       120
     caagtcttaa agtacatggg gggcttcctc cttacggggt ttattgctgc ttgcgggcag       180
     gctggcgggc cacaagcaca gaagagccca gtccccacaa gtatagtcag cagtcagcca       240
     accgctcctt ccagagaagg actgacaaag ctggatctag cgttttgtag ccaggtgctg       300
     tgtatactgc ccttcgaagt agcaagacag caagggtact ttgcggatga gggttacgat       360
     gtaaacctaa tatacatgaa gggtggtgcg ctggctataa atgctctcat ttcaaagagc       420
     gtcgactttg tgggtactcc gatggatcta attgttagat cggtggatca aggccagccg       480
     gtaataatgg ttgcttcaac ctccaggttg ccattcttcg cattagtagt atcgcctggt       540
     aagtcttcag agatcaccaa gattagtgac ctgcaaggca agagagtagg ggttaataac       600
     cttggtacta cagatgatct tctattgaag gcgctactag caaagaacaa tctggatccc       660
     aatagtacag atagcgtggc gcttggtcca aatctatacg acgccctgct ccggggtgag       720
     gtagatgcag ggatggtgca ggaacctgca ctgactttac tctcccaaaa gggtgctaga       780
     gtactagtaa atttcatgga caggcagcag acaaacgagg tactaggtgg cgactaccag       840
     tttatggggc taaacacaag gccggatgtg cttgattcca aaccagatgt ggtcgaaaag       900
     ctggccagag cactggtaaa ggctaatcag tggatactga accacacagg gtccgaaatc       960
     gtaaaggctg ccccacaaga gctagcgccc ggggatgaca tccagatctt tgcaaaagct      1020
     cttgataaat acaaggagag cctttaccca agcgacggcg tgatagaaga acatgccgta      1080
     agaagagtag tagaaacaca gaaaatttct gggttgctaa agaacgagaa tatagatata      1140
     agcacacttt acactaataa gtacgtggag ggctaa                                1176
//

If you have problems or comments...

PBIL Back to PBIL home page