(data stored in ACNUC7421 zone)

EMBL: CP001825.PE229

CP001825.PE229       Location/Qualifiers
FT   CDS_pept        248856..249671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0231"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mlo:mlr7951 ABC
FT                   transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41153"
FT                   /db_xref="GOA:D1CDZ7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDZ7"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ41153.1"
FT                   /translation="MASEQVSNISVAQKQESGESKYLSVYILRWGLLLVFLALWELGAR
FT                   TGFIDTYFYSSPSRIIETLIQQFSTGAIWKHLAATMQAAIFGLIYGFIAGAALGWLAAR
FT                   FKTLSQIVEPVMTLFNSVPRIVIAPMIIMWLGIGIASKIAVAFILVFVVLFFAVYTGIR
FT                   EVNKDLIDRIRLLGGNERDIILNVYVPSVAAWIFSSLRLTVGFAFTGAIVGEYMASSRG
FT                   LGYMLNFAQNSQNADLMLSTVVLIMAIIMLIFALLGRLEARALIWREDR"
     atggcaagtg agcaggtatc taatataagt gttgcgcaga agcaggagag cggggagagt        60
     aagtacctat ccgtatatat ccttaggtgg ggattgctgc tagtattttt ggcgctatgg       120
     gagctaggag ccagaacagg ttttatagat acatactttt atagttcccc tagcaggata       180
     atagaaactc tcattcaaca gttcagcacc ggagccatat ggaaacatct agcagctacc       240
     atgcaggcag ctatctttgg acttatatat ggcttcatag ctggcgcagc tttaggatgg       300
     cttgctgcta ggttcaagac gctaagccag atagtagagc ctgtaatgac actcttcaac       360
     tcagtgccac gcatcgtgat cgcgcctatg atcatcatgt ggctgggaat aggaatcgcc       420
     tccaagatag ctgtggcttt tatactggtg ttcgtagtgc ttttcttcgc cgtgtacaca       480
     ggtattagag aggtgaataa agatctgatc gatcgaatca ggcttctagg aggaaacgag       540
     agagacatta tactcaatgt ctatgtcccc tctgttgcgg catggatctt ctcaagcttg       600
     agacttacag taggatttgc ctttacggga gctatcgttg gtgagtacat ggcatccagt       660
     agaggtctgg gctatatgct caactttgca cagaacagtc aaaacgccga cctaatgctg       720
     tcgacagtag ttcttataat ggctattatc atgcttatat ttgccctttt gggtcggctt       780
     gaagcccgag cacttatctg gcgggaagac aggtag                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page