(data stored in ACNUC7421 zone)

EMBL: CP001825.PE230

CP001825.PE230       Location/Qualifiers
FT   CDS_pept        250059..252536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0232"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: glo:Glov_2744 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41154"
FT                   /db_xref="GOA:D1CDZ8"
FT                   /db_xref="InterPro:IPR018580"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDZ8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41154.1"
FT                   /translation="MLSYKFMKALRYVRAHQRTLPSFFSLELRKLDVLGALGAVSLTLL
FT                   AVAHMVIKGTAVGLDSAVFFYPMYHYLGSSLRSGEIPVWNPFLFSGFPFAASPQSGWMY
FT                   LPAMAFFTLLSLSEAAKTYILFHWVVSAIAVYVLARDLGLSVSGSVLASVAYSINGFSY
FT                   ERTVCCFAYSGVYTWVPVALLGCERAIKTRELLNKWIWIAISSFSLAQIFSAWPGQGFY
FT                   YGFLLIASYLTFRILVFPEHRSGIIARITQLLSTGIIMGILAFGLGAADILPKLSFLSQ
FT                   SNLASGYTLQQAGVHSGWTILESLSLLGPTTWYLGVTVFSLALAAPFLVRTRYMTPFWI
FT                   VWMFACLVLASRSQTLLHLILYEFLPMFRSLHPHDPERIMMTFYIAPSLLAGSTITYLL
FT                   QLDRKRIKRKVYWLILVPPILLAFITAYAASQITIYVSIILLVFSIGLGIYIVNPSAQN
FT                   KILLTLLVLACVFADLYIVNNHVQAQRLQTRMVYALRKVNLESYYSSTKAVKFLRSQGP
FT                   NYTFRFFGYDPRLRWFPGKADPSIPPPGILYRYLWMDYRTKILLVNNRALVTGIQDIQG
FT                   YNPLQLSSYDSFFGVINGQSQEYRSTYVLQRGLSSPLLDLLNARYVITLRSFGPNFPEY
FT                   ESLEKTSRLVYEDSTIRIWERQTALPRAWIVHSWQNAPYEEVLHILANNALDFRKIALV
FT                   EGLESHIQDINPSDDAVTIDHYSQSRITLTTKSHLPGMLILSEVYYPDWRAYLDGKPVN
FT                   IYRAYGLLRAVTIPAGEHKIEFRYESKSLEYGLIISISFYLLVASLLLSKLLTYAKSRT
FT                   MDNIRGRSIDIRN"
     atgctctcgt acaaattcat gaaagcttta aggtacgttc gggcacatca aagaacttta        60
     ccttcctttt tcagcctgga gctaagaaag cttgatgttc taggagcgct aggtgctgta       120
     tccttgactc tgcttgcggt agcccacatg gtaatcaagg gcacagctgt agggctggac       180
     tcagcagtct tcttctaccc tatgtatcat tacctaggaa gctccctaag atccggagag       240
     ataccagttt ggaatccatt tctgttctct ggcttccctt tcgctgcaag tccgcaatca       300
     ggctggatgt acttaccagc tatggcattt ttcacactac tgtctttatc agaagcagcc       360
     aaaacgtaca tcctttttca ttgggtggtt tctgctatcg ccgtatacgt cctcgcacgc       420
     gacctaggat tatccgtatc aggtagtgta ctagcatccg tggcctactc gataaatggc       480
     ttcagctatg aaagaacagt atgctgtttc gcctacagtg gtgtatacac atgggttccc       540
     gtagccctcc ttggctgtga gcgtgcaatc aagactagag aacttttgaa taagtggatt       600
     tggatcgcaa tctccagctt ctctctggca caaatcttct ccgcatggcc agggcaaggt       660
     ttctactatg gattcctgtt gatagcaagc tatctgacat ttaggatctt ggtcttccca       720
     gaacatagat cgggcattat tgcgcgcatc acacagctac tatcaaccgg aataattatg       780
     ggtatactgg cctttgggct gggagccgca gacatcctcc ctaagctaag cttcctaagc       840
     caatctaacc ttgccagcgg ctacactctg caacaagctg gagtacatag cggatggacg       900
     attcttgaat ctctttccct gctgggccct actacatggt acttaggggt taccgtattt       960
     tcgctagcat tggccgcacc cttcttagtg cgtactaggt acatgactcc attctggata      1020
     gtatggatgt ttgcttgctt agtcttagcc agcagatctc agaccctgtt gcacctcata      1080
     ctgtatgagt ttctacccat gttcagatct ctccatcccc atgatcctga gcggataatg      1140
     atgactttct atatagcccc atcattattg gcaggatcaa caataacata cttattacaa      1200
     ctagacagaa agcggatcaa gcgaaaggtt tactggctaa tcttggtccc acccatttta      1260
     ttagcgttca taactgctta tgcagcctca cagataacaa tatacgtttc catcatattg      1320
     ctcgtattct caataggact tgggatatat atagtaaatc caagcgctca aaataaaata      1380
     cttctgactt tactggtctt agcctgtgtg ttcgcagacc tatacatagt caacaaccat      1440
     gtacaagcac agcgactgca gacccgtatg gtctacgcac tccgaaaggt taatctagag      1500
     agttactaca gttctacaaa agctgttaag tttttgaggt ctcaaggccc taattacaca      1560
     tttaggtttt tcggatacga cccaaggcta cgctggttcc ctggcaaagc cgatccaagt      1620
     attccgcccc ccgggatcct atatagatac ctgtggatgg actacagaac caaaatcctg      1680
     ctagttaaca accgagctct cgtgactggt attcaagata tccaagggta caatcctcta      1740
     caactatcga gttatgactc cttttttgga gtaataaacg gccaatcgca ggaatataga      1800
     agcacttacg tcttacagag agggctctct tcacctctac tggatctgct caatgcgaga      1860
     tacgtgatca ctctaaggag cttcggcccc aattttccgg aatacgaatc tctagagaaa      1920
     acctcgagat tggtatatga agattcaacg attcgtatat gggaacgcca gacggcattg      1980
     cccagagcat ggatagtaca ttcctggcag aatgccccat acgaagaggt tctacacatc      2040
     ttggcaaaca acgccctaga tttcagaaag atagcactgg tagaaggtct tgaaagccac      2100
     atacaagaca taaatccttc agatgacgcc gtaactatag atcactattc acaatctaga      2160
     ataacactaa ccactaagtc tcacttgcca ggaatgctta tactgagcga ggtttactat      2220
     cccgactggc gagcttatct agatggaaag ccagtgaaca tctaccgcgc atacggctta      2280
     ctacgtgctg taaccattcc ggcaggggaa cataagatag agttcaggta tgaatctaag      2340
     tctttggagt acgggcttat aatctctata agcttttacc tgctggtagc ttccttgcta      2400
     ctgtcgaaat tgttaacata tgcaaaatcc aggactatgg ataacataag gggtaggagt      2460
     attgatatta gaaactag                                                    2478
//

If you have problems or comments...

PBIL Back to PBIL home page