(data stored in ACNUC7421 zone)

EMBL: CP001825.PE231

CP001825.PE231       Location/Qualifiers
FT   CDS_pept        252520..253437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0233"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; Methyltransferase
FT                   type 11; KEGG: dol:Dole_2627 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41155"
FT                   /db_xref="GOA:D1CDZ9"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDZ9"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ACZ41155.1"
FT                   /translation="MILETSDLEYIDCNLCGSKSHSLFLPANTDFSQISANALACTSIH
FT                   HSKHGPIVRCNNCGLIFANPRPSPQKIIEIYSQVEDHVYLAEEEGRVATFKNNLAEISR
FT                   YKRKGKLLDVGCHVGTFLDIAKDYGYEVYGLEPSKWAAEYCRNKRNIEVQECGLSEANL
FT                   EDSSFEVITMWDVIEHLTDPYKELRRANSLLRDDGILAITTMNVDSVFAKVLGKHYPWY
FT                   MLMHLYYFTPDTMEKILGKSGFRILEIKHHIRVVSLRYLFSKIKAYSPAAYRAAHTVAH
FT                   LLKIHDLKVPLNFGDIMTVIARKI"
     ttgatattag aaactagtga tcttgaatat atcgactgta acctatgtgg aagcaagagt        60
     cactcattgt ttctgccagc aaacactgac ttctcacaga tctcagctaa cgctctagct       120
     tgtacaagca tccaccatag caaacatgga cctattgtga ggtgcaataa ttgcggcctg       180
     atatttgcca atcccagacc ttctccacag aaaataatcg agatctactc acaagtagag       240
     gatcatgtat atcttgccga agaagaggga cgagtagcca ccttcaagaa caaccttgct       300
     gagatctcca gatataaaag aaagggcaag ttgctggatg tgggatgcca cgttggcaca       360
     tttttggata tagctaaaga ctatggctat gaggtctacg ggcttgaacc atcaaagtgg       420
     gcagctgagt attgcaggaa taagagaaac atagaggtac aggaatgcgg cctttctgag       480
     gcaaatctgg aggatagtag cttcgaagta ataaccatgt gggatgttat agagcacctt       540
     acagatcctt ataaggaact cagaagagca aactcgttgc taagagacga cggcattttg       600
     gcaatcacca ctatgaacgt agattccgtg ttcgccaagg tattggggaa gcactatcct       660
     tggtatatgc taatgcactt atattacttt acgccagaca caatggagaa aatacttgga       720
     aaatcagggt tcagaattct ggaaatcaag catcacatta gggttgttag cctaagatat       780
     ctcttctcca agataaaagc ctacagtcca gcagcctata gagctgctca taccgttgct       840
     catctcctaa agatacatga tcttaaggtt cctttgaact ttggagatat catgacggtc       900
     atagccagaa agatatag                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page