(data stored in ACNUC7421 zone)

EMBL: CP001825.PE232

CP001825.PE232       Location/Qualifiers
FT   CDS_pept        253460..254419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0234"
FT                   /product="ribonuclease BN"
FT                   /note="TIGRFAM: ribonuclease BN; PFAM: ribonuclease BN;
FT                   KEGG: pap:PSPA7_2488 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41156"
FT                   /db_xref="GOA:D1CE00"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE00"
FT                   /inference="protein motif:TFAM:TIGR00765"
FT                   /protein_id="ACZ41156.1"
FT                   /translation="MSFLVPYLNKLEQLGNKIRVPLARHIGIADLLKQVWKEASEDHLG
FT                   DFAASLTYHGIFAIFPFLTFLISMLGIFDKVLGVFDTSQLIKDFLSRPQVRQAIPVEVI
FT                   DFVQQQIDRLIGNIRPGTFTTGAIVSVLLALWGVSGAFRSIMESLNVVYEIKDSRPIWK
FT                   KYLISIMLSVIAVLLLLSAGILAVFGPKIADWLARTTGLGTLFAWSWKIAQWPLLILIA
FT                   LLAFALIYHYGPDIKQPLRLVTPGSILALLGWLVFTLIFSLYVNNFGNYNKTYGTLAGA
FT                   ILLMLYMYYSSYILLMGGEVNHVVETYSKTSEEVKQSV"
     atgtcatttc tggttccgta tctgaacaag ctggaacagc taggtaacaa gattagggtt        60
     ccactggcaa gacacatagg aatcgcagat ctgctaaagc aagtctggaa ggaagcctcg       120
     gaagatcact tgggggattt tgcagccagc ctgacctatc atggcatatt tgccattttc       180
     ccttttctga ctttcctaat atctatgctg ggaatatttg acaaagtgct gggcgtattt       240
     gacacctctc agctaataaa agacttctta tcacgccccc aggtcaggca agctatacca       300
     gtagaggtca tagatttcgt acagcaacag atagatagac ttataggtaa cataagacct       360
     ggaactttta ctacaggtgc catagtatcc gtactcttag ccctatgggg agtatcgggg       420
     gcctttaggt cgatcatgga atctctcaat gtagtgtacg agataaaaga ttcaagaccg       480
     atctggaaga agtaccttat atcgataatg ctatctgtta ttgctgtact attactgctg       540
     agcgcaggca tactagcagt ctttggacct aagatagcag attggctggc tcgtaccacc       600
     ggtctaggaa cgctctttgc ctggagctgg aagatagctc aatggccctt gcttatactt       660
     atagctctat tagcctttgc acttatctat cactacggcc cagatatcaa gcagccactc       720
     agactcgtaa caccaggctc gatcttagcc cttcttggct ggctagtctt cacacttata       780
     ttctccttgt atgtaaacaa ctttggtaac tacaacaaga cctacggaac gttggccgga       840
     gccatattac tgatgcttta catgtattac tcctcttaca tactcctaat gggtggcgag       900
     gtcaaccatg tcgtagagac ctacagcaag accagcgagg aagttaagca aagcgtataa       960
//

If you have problems or comments...

PBIL Back to PBIL home page