(data stored in ACNUC7421 zone)

EMBL: CP001825.PE233

CP001825.PE233       Location/Qualifiers
FT   CDS_pept        254462..254902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0235"
FT                   /product="CcmE/CycJ protein"
FT                   /note="PFAM: CcmE/CycJ protein; KEGG: dds:Ddes_2369
FT                   cytochrome c-type biogenesis protein CcmE"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41157"
FT                   /db_xref="GOA:D1CC97"
FT                   /db_xref="InterPro:IPR004329"
FT                   /db_xref="InterPro:IPR036127"
FT                   /db_xref="UniProtKB/TrEMBL:D1CC97"
FT                   /inference="protein motif:PFAM:PF03100"
FT                   /protein_id="ACZ41157.1"
FT                   /translation="MWYTAKGMAQAVAVDTTRRRNLGLLVVGLVAAAAILYLVVSNFSA
FT                   NTVYYLKVSELQSSYHGGQVRVSGKVLPGSISRQGDKLSFTAYDGSGRMRVEYQGVVPD
FT                   IFKDNADVVVEGTYDGQVFHAHTLLAKCPSKFQSKPSQGYAQ"
     atgtggtata ctgccaaggg aatggcacaa gctgtagcgg tagacaccac aaggagaaga        60
     aacctgggac tgctagttgt gggactggtg gcagctgccg ccatcctcta tctggtggtc       120
     tccaacttct cggccaacac cgtctactac ctgaaggtct ccgagctgca gtcctcctat       180
     catgggggac aggtcagggt gtcaggcaag gtgttgcctg gctccatctc caggcaagga       240
     gacaagctca gcttcacagc ctatgatggt tctggcagga tgagggtgga gtatcagggt       300
     gtggtgccgg acatcttcaa ggacaatgct gatgtggtgg tggagggcac ctatgatggg       360
     caggtgttcc atgcccacac cctgcttgcc aagtgcccct ccaagttcca gtccaaaccc       420
     tcccaaggat atgcccagtg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page