(data stored in ACNUC7421 zone)

EMBL: CP001825.PE234

CP001825.PE234       Location/Qualifiers
FT   CDS_pept        254940..255683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0236"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sus:Acid_4236 heme exporter protein CcmA"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41158"
FT                   /db_xref="GOA:D1CE02"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE02"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ41158.1"
FT                   /translation="MFSNKPSQSMSDPVPVIEAQGIGKLYNRRWALRNVNIKVFAGERV
FT                   LLWGPNGSGKTSLLRILATLSRASRGELKLFGLEAIKYKRDLRNRIGYLGHNLTLYDDL
FT                   TARENLNLYSKLYSVKNPENLYMPLIYTFGLVSFLDSRVRNYSRGMQQKLAIVKALIHQ
FT                   PEILLLDEPSTGLDAESTHKLEEVLAQYDGTIVFSSHDLEFGLSVGNRVLVLSNGSIIA
FT                   DKSVQEIDSIDLQHPTQRHKLTIQP"
     atgttttcca acaaaccctc acaatcgatg agtgaccccg tacctgttat agaagcccaa        60
     ggtataggaa agctttataa ccgacgttgg gcactaagga acgtaaatat caaagtcttt       120
     gctggggaga gggttctatt atggggacca aatgggtctg gcaaaacatc tctgctaagg       180
     attttggcta ctctgtccag agccagcagg ggggagctaa agctctttgg acttgaagcg       240
     ataaagtaca agcgtgacct acgaaataga ataggttatc taggtcataa cctaaccctc       300
     tatgacgacc tcactgcaag ggaaaatctc aacctgtact cgaagcttta ctcagtaaag       360
     aaccctgaaa acctctacat gcccttgata tatacttttg gcttggtatc ttttctagat       420
     tccagagtgc gcaactactc cagaggcatg caacagaagc tagcgatcgt caaggccctg       480
     attcatcaac cagaaatact actgttggac gagcccagca caggactcga tgcagagtct       540
     actcacaaac tggaagaggt tcttgcccag tacgatggca cgatagtctt cagcagccac       600
     gaccttgaat ttggattaag tgtaggcaat cgtgtattgg tattatctaa tggaagcata       660
     atagcagata agagcgtaca ggagatcgac tcaatagatc tacagcatcc cacacaaagg       720
     cataaactaa ccatccaacc atga                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page