(data stored in ACNUC7421 zone)

EMBL: CP001825.PE235

CP001825.PE235       Location/Qualifiers
FT   CDS_pept        255680..256351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0237"
FT                   /product="cytochrome c-type biogenesis protein CcmB"
FT                   /note="PFAM: cytochrome c-type biogenesis protein CcmB;
FT                   ABC-2 type transporter; KEGG: mgm:Mmc1_3499 cytochrome
FT                   c-type biogenesis protein CcmB"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41159"
FT                   /db_xref="GOA:D1CE03"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="InterPro:IPR026031"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE03"
FT                   /inference="protein motif:PFAM:PF03379"
FT                   /protein_id="ACZ41159.1"
FT                   /translation="MKFWQQVLALVHKDLVLEIRRKEIIISMFVFALQILVIFNYAFDL
FT                   RVENVKSIGPGVIWVSIFFSCAVNVGRTIFLEKERGGWEGLITAPLELGALYVAKLIGN
FT                   ILFMLFAEVLILPMFVVLFNLQVITLPIITVLILGTIGFASISTMFAGLLASTRAREIM
FT                   LPVLIFPILLPVTIATVEATANHLTGTTAMNRAPWTGLLIAFDALFICAGYILFDQVLE
FT                   E"
     atgaaatttt ggcaacaagt cctagcctta gttcacaaag acctggttct cgagataagg        60
     cgaaaagaaa tcattatctc aatgttcgtc tttgccctcc agatacttgt catattcaac       120
     tacgctttcg atcttcgggt agaaaatgta aaatcaatag gacccggagt aatctgggtg       180
     tcgatattct ttagttgcgc agtaaacgtg gggcgtacca tatttctcga gaaagagcgc       240
     ggaggttggg aaggtcttat aacagccccc ttggagttag gggctttgta tgttgctaaa       300
     cttataggaa atatcctttt catgttgttt gcagaagtcc tgatactacc gatgtttgtg       360
     gtgttgttca atctgcaggt tattacactg cctataataa ctgtcttgat attaggcact       420
     atagggtttg catcgataag cactatgttc gcagggcttc tagctagtac cagagcaaga       480
     gagatcatgc tgccagtact tatattccca atacttctac ccgtaaccat agctactgtg       540
     gaagccacag ctaatcactt gactggcaca acagctatga acagagctcc atggacgggc       600
     cttctaatag cctttgatgc gctattcata tgcgctggtt acatattatt tgatcaagtc       660
     ttagaggagt aa                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page