(data stored in ACNUC7421 zone)

EMBL: CP001825.PE236

CP001825.PE236       Location/Qualifiers
FT   CDS_pept        256356..257075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0238"
FT                   /product="cytochrome c assembly protein"
FT                   /note="PFAM: cytochrome c assembly protein; KEGG:
FT                   aba:Acid345_2302 cytochrome c assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41160"
FT                   /db_xref="GOA:D1CE04"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE04"
FT                   /inference="protein motif:PFAM:PF01578"
FT                   /protein_id="ACZ41160.1"
FT                   /translation="MAQITAAVQSTRYYGWVDKLSQVLAFVTLPLMALTLYMTLIYAPT
FT                   DATQGDVQRIFYYHVPTAWNGFLAFFLVFVASVVYLFKSSRFWDALARASAEVGLVFTT
FT                   IMIITGSLWGKPVWGTWWSWDPRMTTTLILWFIYLGYLMLRAYAPSKQQGARYAAVLGI
FT                   VGFVDVPIVYMSTKWWRTLHPQQVVEPGQVSMPPEMLQAFMVSLLAFTLLFIWILIIRT
FT                   RIALIEDELEIRSIENG"
     ttggcacaaa taacagcagc agtacaatct acacgttatt atggctgggt agacaagctg        60
     agccaagtgc tagcgtttgt taccttgcca ctcatggcac taactcttta catgacattg       120
     atatatgccc ccacagatgc cacacaaggt gacgtgcaac gtatcttcta ctatcacgtt       180
     cccaccgcat ggaacggctt cctggcattt ttcctagtgt ttgtggctag cgtcgtgtac       240
     ctcttcaaga gcagtcgctt ttgggatgca ttggcgcgtg cttctgctga ggtgggtctt       300
     gtctttacaa ccattatgat catcaccgga tccctttggg gcaagccagt atggggtaca       360
     tggtggagtt gggatccaag aatgaccacc actctaatcc tgtggttcat ctaccttgga       420
     tacctcatgc taagagctta tgctcccagc aaacaacaag gcgcgcgcta tgccgcagtg       480
     ctagggatag ttggtttcgt ggacgtacct atagtctata tgtctaccaa gtggtggaga       540
     accctccacc cacaacaggt cgtagagcct ggccaggtta gcatgcctcc cgagatgcta       600
     caggcattta tggtatctct cttagctttc accttgctct ttatatggat tcttatcata       660
     agaacaagaa tagcgctaat agaggatgag ctagaaatca ggagtataga aaatggataa       720
//

If you have problems or comments...

PBIL Back to PBIL home page