(data stored in ACNUC7421 zone)

EMBL: CP001825.PE237

CP001825.PE237       Location/Qualifiers
FT   CDS_pept        257068..257223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41161"
FT                   /db_xref="GOA:D1CE05"
FT                   /db_xref="InterPro:IPR030888"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE05"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41161.1"
FT                   /translation="MDNFGFLFAALLVVWIGIFVYIYYIGQKLNDLRQQLSEVEIRENQ
FT                   NTKEDQ"
     atggataatt ttggatttct tttcgctgca ttacttgtcg tatggatagg tatcttcgtc        60
     tatatctact acattggtca gaaactcaac gacctccgtc agcaactatc ggaagttgaa       120
     attcgagaaa accaaaatac gaaggaagat cagtaa                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page