(data stored in ACNUC7421 zone)

EMBL: CP001825.PE239

CP001825.PE239       Location/Qualifiers
FT   CDS_pept        257834..258766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0241"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   pzu:PHZ_c1916 probable periplasmic substrate- binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41163"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE07"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ACZ41163.1"
FT                   /translation="MRIVSLLPSATEIVCSLGLIDSLVGVTHECDYPPEVMGKPILTRS
FT                   LIDTTQDSYSIDRQVVESLHEHRTLYALDEELLRELSPDLILTQELCDVCAVSYTVVEK
FT                   AARILPAETPVVSLEPNTLYDILETILLVGRLTGTEARAQKLIDELITRIRAVESKASS
FT                   VAHKPKVYCMEWVNPPYKSGHWIPEMVRIAGGEEVFGLEGIPSSRASWEEIAQAAPEVV
FT                   VVMACGFDADRTERELMLINEREEWQSLPAVRNGNVWVSNGSAYFARPGPRIVDSLEML
FT                   AHAIHPELFPEPDRTQFRRFRPLAAASLV"
     gtgcgtatag tatccctgct gccaagtgct actgaaattg tttgctccct cgggctcata        60
     gatagcctgg tgggagttac acatgaatgc gattaccctc cagaagtaat gggtaagcct       120
     atacttacca ggtcgttgat agatactact caagacagtt attcgataga taggcaagta       180
     gtagagagcc tacatgagca ccgcacacta tacgcactag atgaagaact acttagagag       240
     ctatctcccg atctaatcct gacccaggaa ctatgtgacg tttgtgcagt gtcgtatacc       300
     gttgtagaga aggctgcacg catactaccc gctgaaacac cagtagtatc cctggagcct       360
     aacacgctat acgatatact tgagaccatc ctacttgtag gcaggcttac cggtacggaa       420
     gcaagagcac agaagctgat agatgaactg ataacacgca tcagagcggt agagtctaag       480
     gcctcgtccg tagcccacaa acccaaggta tattgcatgg aatgggtaaa ccctccctat       540
     aaatctggcc attggatccc tgagatggtt aggatagccg gaggagaaga ggtctttggt       600
     cttgagggca tcccttcgag cagagcttct tgggaagaaa tagctcaggc tgcacctgaa       660
     gtagtagtag taatggcctg tgggttcgat gccgatagaa ccgagcggga gctgatgcta       720
     atcaatgaaa gggaagagtg gcaatcgctg cctgctgtta ggaacggtaa tgtatgggta       780
     tccaacggat cggcttactt cgcgcgtcct ggtccaagaa tagtggactc tcttgagatg       840
     cttgcgcacg ccatacaccc agagttgttc ccagagccag acagaactca attcagaaga       900
     tttagacctc tggctgccgc atctctagtc tag                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page