(data stored in ACNUC7421 zone)

EMBL: CP001825.PE24

CP001825.PE24        Location/Qualifiers
FT   CDS_pept        complement(25480..26640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0025"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   KEGG: bar:GBAA0004 recombination protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40948"
FT                   /db_xref="GOA:D1CDE2"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDE2"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ACZ40948.1"
FT                   /translation="MPNGPILVLGPNASGKTTLLEAIYLLATTKSHRAGSDRELINWNT
FT                   ESEEGVPAFARVAAEVRRRSPIQVEITILKESTAQGENVRKRIRVNGVNKRAIDLIGQV
FT                   NVVMFGPQDLDLIVGAPSLRRRYLNITISQLDHQYVRTLQTYERVVLQRNTLIKALSDR
FT                   AFKLRDESINDQFAYWDNELVNQGSYLLARRLEILSRMNELASMVHSKLTGSSQELSIA
FT                   YKSTLFDSLPLQLDNPREEEIRDLYIKKIHDLRREELRRGMTLVGPHRDDISFLVGGVD
FT                   VGVYGSRGQQRSVILAIKLAEVDLMKSITGDLPILLLDDVVSELDPERRRYLLQNVLQL
FT                   SQQALVTTTDLLTIGREFLAEASLFETTSTGLLQPMKRTWKIGGER"
     ttgcccaacg gccctatact cgtccttggt cccaacgcga gtggcaagac tacgttgctt        60
     gaggccatat atctactcgc taccactaaa tcacatcggg ctggctcgga tcgagagctc       120
     atcaattgga acacggagag cgaagagggt gtgccggctt tcgcacgcgt ggcagcagag       180
     gtgagaaggc gtagcccaat acaggtggag atcactatcc tgaaggaatc taccgcacag       240
     ggcgagaacg tacgcaagcg tatacgtgtc aacggtgtaa ataagagggc tatagacctt       300
     ataggacagg tgaacgtggt tatgttcggg ccccaggacc tcgaccttat agtcggagct       360
     cccagcctcc gaaggcgtta tcttaacatt acaatttcgc agttggatca ccagtacgta       420
     aggacgttgc agacctatga gcgtgtagtg ctccagcgta acaccctaat caaggctctt       480
     tcagatagag cctttaagct gagagatgag tctataaacg accagtttgc ctattgggac       540
     aatgagctag tcaatcaagg gtcataccta cttgccaggc gcttggagat cctgagtagg       600
     atgaatgagc tagccagtat ggtacatagc aagctgaccg gatcctctca ggagctgagt       660
     attgcttata aatccacact attcgactca ctgcccttac agttagataa tccacgcgag       720
     gaggaaataa gggatctata cataaagaag attcatgatc tgcgtcggga ggagcttagg       780
     cgcggcatga cgttggttgg cccccataga gacgacataa gctttcttgt gggaggcgtt       840
     gatgttgggg tttatggttc gagagggcag cagcgctctg tgatactggc tataaagctt       900
     gctgaggttg atcttatgaa gagcattact ggagaccttc ctatcttgct actggatgat       960
     gtggtgtctg agcttgatcc tgagagaagg agatacctgc tccagaacgt gctacagctg      1020
     tcacaacagg cattggtgac taccacagac ctgctgacta taggcagaga gtttcttgct      1080
     gaggcttctc tatttgaaac tacatcgacg ggacttctac agcccatgaa gagaacctgg      1140
     aaaattggtg gagaaagata g                                                1161
//

If you have problems or comments...

PBIL Back to PBIL home page