(data stored in ACNUC7421 zone)

EMBL: CP001825.PE242

CP001825.PE242       Location/Qualifiers
FT   CDS_pept        259790..261304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0244"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /note="KEGG: gur:Gura_3250 4-alpha-glucanotransferase;
FT                   TIGRFAM: 4-alpha-glucanotransferase; PFAM: glycoside
FT                   hydrolase family 77"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41166"
FT                   /db_xref="GOA:D1CE10"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE10"
FT                   /inference="protein motif:TFAM:TIGR00217"
FT                   /protein_id="ACZ41166.1"
FT                   /translation="MNDHRRSGVLLHLTSIPTKYSIGDMGPKAYEFLDFITSSGLSIWQ
FT                   MLPVGPVGKSNSPYQSYSAFAGNHLLISPDLLLEEGILATADLPKEPNTKHQRTDYALA
FT                   RRIKSLILQKAFSRFTPTKDFESFCEEYSYWLDDYAMFMTLLELNNGRPWNLWHTDISR
FT                   RDKTTLERLSREHKQRIMFHKFAQYLFFKQWFELKKACNSRGVKILGDLPIFVAHNSAD
FT                   VWAHPEIFKLKPDGNPRMIAGVPPDYFSSTGQLWGNPLYDWQMLEAQNYSWWIDRLKWS
FT                   LKLFDMVRIDHFRGFCACWEVPYGETTAVNGRWVKVPGAKFFRTAIKALGSLPVIAEDL
FT                   GVITPEVEALRDKFGFPGMKVLQFAFTNPQNQYLPHNYVTFNCVVYTGTHDNNTTLGWW
FT                   EELDSKHKSIVRSYVGRKTGKDLVWELIRMGISSTAKYAIFPLQDFLTLGSEARMNIPG
FT                   TEFGNWEWSYPESALSEEIAGRIKHLCKLYNRVPPEEKEQQITNPQ"
     atgaatgatc acagaagaag tggtgtgtta cttcacctaa catcaatccc caccaagtac        60
     tctataggag atatggggcc caaagcttat gaatttctgg attttattac aagtagcggg       120
     ctaagcatat ggcaaatgtt accggtaggt ccagttggaa aatctaattc tccgtaccaa       180
     tcctattcgg cctttgccgg caaccaccta ctgataagtc cagatctgct gctcgaggag       240
     ggaatactgg caacagcaga cttaccaaaa gagcctaata ccaagcatca gcggacagat       300
     tatgccctcg caagaaggat aaagtcactc attctacaga aagccttctc aaggtttacc       360
     cctaccaagg attttgagtc cttttgcgaa gaatacagct actggctaga tgattatgca       420
     atgttcatga cactccttga gctgaataat ggtaggccct ggaacctttg gcacactgat       480
     atctccagaa gagacaagac gacgctagaa agattaagta gagagcataa gcaaaggata       540
     atgttccata agttcgccca atacttgttc ttcaagcaat ggtttgagct aaagaaggca       600
     tgtaattctc gcggcgttaa gatcctagga gatctgccca tatttgttgc tcataacagc       660
     gcagatgttt gggctcatcc agaaatattt aagctcaaac cagatggtaa cccacgcatg       720
     atagctggtg ttccaccgga ctatttcagc agcaccgggc agctatgggg caaccccctc       780
     tatgactggc agatgctaga agctcaaaat tattcttggt ggatagatag actcaagtgg       840
     tcacttaagc tctttgacat ggtaaggata gaccatttca ggggtttctg cgcttgctgg       900
     gaagtaccat atggagaaac aaccgcagta aatggtaggt gggtaaaggt tcctggggca       960
     aagttcttca gaacagccat aaaagcttta ggttcactgc ctgtaatagc tgaagactta      1020
     ggggttatca ctccggaagt agaagcgctg cgtgacaagt ttggcttccc gggcatgaag      1080
     gtactacagt ttgcattcac gaacccacaa aatcagtact tgcctcacaa ctacgtaacc      1140
     ttcaactgtg tagtgtatac cggcacgcac gacaacaaca ctacactggg ttggtgggaa      1200
     gagctagaca gcaaacataa atctatagtt agaagctatg tagggagaaa aactggaaag      1260
     gatttagtat gggagcttat tagaatgggg atctcctcga ctgcaaagta tgcaattttc      1320
     ccgctacaag attttctaac tctcgggtca gaggcgagga tgaacatccc tggtacagag      1380
     ttcggaaact gggaatggag ttatcctgaa agtgcgctat ccgaggaaat tgcaggcaga      1440
     ataaagcatc tatgcaagct gtacaatagg gtacctccag aggagaaaga gcaacagatt      1500
     acaaatcccc agtaa                                                       1515
//

If you have problems or comments...

PBIL Back to PBIL home page