(data stored in ACNUC7421 zone)

EMBL: CP001825.PE245

CP001825.PE245       Location/Qualifiers
FT   CDS_pept        262800..263273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0247"
FT                   /product="blue (type 1) copper domain protein"
FT                   /note="PFAM: blue (type 1) copper domain protein; KEGG:
FT                   aba:Acid345_1788 plastocyanin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41169"
FT                   /db_xref="GOA:D1CE13"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE13"
FT                   /inference="protein motif:PFAM:PF00127"
FT                   /protein_id="ACZ41169.1"
FT                   /translation="MKTWIKPLIALLILLLVAMPSKVSATTNTTHKVEVDDNYFEPKTI
FT                   TIRVGDTVEWENEGQNPHTVTADDGSFDSGNLNSGDSFSHTFTKAGKYAYYCKYHGAAG
FT                   GVGMAGTVVVMSGPAQTGAGGMANHESLLPILLLVVGVVILYLGLRFKYNRIS"
     atgaagactt ggattaaacc tcttatagca cttctaatcc tattgctagt cgcaatgcct        60
     tccaaagtgt cagctaccac gaatactact cataaagtgg aggttgatga caactatttt       120
     gaacccaaaa ctatcaccat acgtgtgggc gacaccgtcg agtgggaaaa cgaaggtcag       180
     aatccccata cagtaactgc tgacgacggt agcttcgact caggaaacct taattctgga       240
     gatagcttta gtcacacatt tactaaagca ggtaaatatg cttattactg caagtatcat       300
     ggcgccgcag gcggtgtagg tatggcaggc actgtagtag taatgtctgg acctgcccaa       360
     acgggagctg ggggtatggc taaccacgag agcttactcc ccattttgtt gctggtagta       420
     ggggtagtca tactctatct aggactgaga ttcaaatata accgcatatc ataa             474
//

If you have problems or comments...

PBIL Back to PBIL home page