(data stored in ACNUC7421 zone)

EMBL: CP001825.PE246

CP001825.PE246       Location/Qualifiers
FT   CDS_pept        complement(263289..265184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0248"
FT                   /product="peptidase S9 prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="PFAM: peptidase S9 prolyl oligopeptidase active site
FT                   domain protein; dienelactone hydrolase; WD40 domain protein
FT                   beta Propeller; KEGG: aba:Acid345_2116 peptidase S9, prolyl
FT                   oligopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41170"
FT                   /db_xref="GOA:D1CE14"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE14"
FT                   /inference="protein motif:PFAM:PF00326"
FT                   /protein_id="ACZ41170.1"
FT                   /translation="MGQADWTIEDVLNLRHVEDAQISPDGKYVAYVIRDAYREELKVRS
FT                   SHIYVADITTGESKQFTSGPGADACPRWSPDSNKLAFISDREEEARFDLFTIDVHGGEA
FT                   IKLADLEGSVLDLRWSPDGRYIGLLLEVSRNPHEDSPMVFEEKDQATRIWKVASSGGDA
FT                   EPLSPEGLHVWEFEWLEDSSALVAVCSRYPYEWSWYEPFLALIDASSSEYKVLYSPDKQ
FT                   IANPAPSPDSKHIAFIKGSFSDRGSVGGEVCVVDLQGGMYRSLTEDYPGSFCSVRWLNS
FT                   SCVLAIGYENGNACLLALSLDGNRRRLWLEESMVSHRWCARFTLNRHKNFGVLIKESHS
FT                   SPPDVWSFALSDSDISEWKKITDVFPDLRSKYNGEPKTIVWKSSDGLDIQGIFLHPRNF
FT                   SGVKPPLVTIVHGGPSSMYHHSFLGSYFLAPVLVSNGYAVFLPNPRGSYGWGTAFAEAN
FT                   LGDMGGMDKEDIISGIEYLLELGYVDPSRLAIAGWSYGGFMTAWMITQTDIFKAAVMGA
FT                   GIANWRSFHGVTNIPTWDKLYYRDDPYKLGGRFDKFSPVNWVSSAKTPTLILHGEKDAC
FT                   VPVGQAYEMYRALREHQVTTKLVVYPGQGHGIDKKSYVRDMYERILDWFGEHLRE"
     atgggtcaag ctgattggac tatagaggat gtgttaaatc taaggcatgt tgaggatgcg        60
     cagatatctc cagatggcaa atacgtggct tatgtaatca gagatgctta cagggaagag       120
     ttaaaagtta ggtcttccca catttatgtg gctgacataa cgactggaga atcaaaacag       180
     tttactagtg gtcctggggc ggatgcctgc ccacgttgga gtccagactc caataaacta       240
     gcttttatct cagatagaga ggaagaggcc agatttgatc tctttactat cgatgttcac       300
     ggtggtgagg ctatcaagct ggcggatttg gaaggttcgg ttttggacct aagatggtcc       360
     ccagatggaa gatatatagg tctgttatta gaagttagta ggaatccaca tgaggattcc       420
     cccatggtgt ttgaagaaaa agatcaggcg actcgaatct ggaaggtagc ctcatcaggt       480
     ggagatgctg agcctctatc acctgaaggg ctgcatgtat gggagtttga gtggctggag       540
     gactcttctg ccttagttgc tgtatgttca agatatccat atgaatggag ctggtatgag       600
     ccttttcttg ctctaattga tgcttcatca agcgaatata aagttctata ctcaccagat       660
     aagcaaatag caaatccagc gccctctccg gattcgaagc atatagcctt cataaagggt       720
     tcttttagtg acaggggtag cgttggaggt gaggtatgtg tggtagatct acaaggtggt       780
     atgtataggt ctcttacgga ggactaccca ggaagtttct gctcagtacg ttggttgaac       840
     tcttcttgtg tgctggccat aggttatgag aacggcaacg catgtctatt agcgctgtct       900
     cttgatggta atagacgcag actttggttg gaagaatcca tggtgtccca tcgatggtgc       960
     gctcggttta ctctgaatag acacaagaac tttggggtgc taataaaaga gtcgcattct      1020
     tcacctcctg atgtatggtc ttttgccctt tctgatagtg atattagtga gtggaaaaag      1080
     attacagatg tttttccaga tctacgatct aagtacaatg gagaacccaa gaccatagtc      1140
     tggaaaagca gcgacggctt agatatacag ggtatatttt tgcaccctag aaactttagc      1200
     ggggtaaaac cccccctagt gaccatcgta catggagggc ctagctccat gtaccatcat      1260
     agctttttgg gcagctactt tctggctcct gtcctggtat cgaacggtta tgcagttttc      1320
     ttgcctaatc ccagaggtag ctatggctgg ggaaccgcct ttgcagaagc taacctaggc      1380
     gatatggggg gtatggataa ggaagacata atctcaggta tagagtattt actagagtta      1440
     ggatatgttg acccaagcag attagccata gctgggtgga gttatggcgg gttcatgaca      1500
     gcttggatga tcacccaaac agacatattc aaagctgcag tcatgggagc tggtattgct      1560
     aactggagga gttttcatgg cgttaccaat attcctacct gggataagct ctactacaga      1620
     gatgatccat acaagctagg tggccgcttt gataaattct ctcctgttaa ctgggttagc      1680
     agtgctaaga ctcctacctt gatacttcat ggagaaaagg atgcatgtgt gcctgtagga      1740
     caggcttacg agatgtaccg agccctaagg gaacaccaag tgacaaccaa gttagtcgtt      1800
     tatccggggc aagggcacgg catcgataag aaatcctacg tccgagatat gtacgaacgt      1860
     atactggatt ggtttgggga gcacctaaga gaatag                                1896
//

If you have problems or comments...

PBIL Back to PBIL home page