(data stored in ACNUC7421 zone)

EMBL: CP001825.PE247

CP001825.PE247       Location/Qualifiers
FT   CDS_pept        complement(265211..266122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0249"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; Male sterility
FT                   domain; polysaccharide biosynthesis protein CapD; short-
FT                   chain dehydrogenase/reductase SDR; dTDP-4-dehydrorhamnose
FT                   reductase; KEGG: bja:bll0593 putative oxidoreductase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41171"
FT                   /db_xref="GOA:D1CE15"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE15"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACZ41171.1"
FT                   /translation="MSKVLITGAAGTLGQALIPVIAGAGYHLELVDIQPIESEYEFHQI
FT                   DILDADALSPVMEGVDFVVHAAGLHGIHLSTRSPREFYSINLTGTFNVWEASAQAGIKG
FT                   FVFCSSVSVYGESRRPPREDAVVALSENMPLLPSDIYGLTKFLGEEMSRYYVRRYGVPA
FT                   VALRLGMFTPEPFFRHGIRLLYGGVDPRDVAQAVLKSIQAMEAGKIRWEVLNIASEVPF
FT                   TKEDGPQLRKNPLPVLDKYYKDAVNLLKERGVERLYPIHEFIPISKAEEKLGFRPEYNF
FT                   SWWLQELEQHPDYRTPKNPPWP"
     atgtctaaag tactaattac tggggcggct ggcactttag gacaggcatt gatacctgta        60
     atagcaggtg ctggatatca tctggaactc gttgatatac aaccgattga gtctgaatat       120
     gaatttcacc aaatagatat cttggatgcg gatgctctgt cccctgttat ggaaggtgtg       180
     gattttgtag tccacgctgc tggcttgcat ggtatacatc tttctactcg tagcccaaga       240
     gaattctatt ctataaactt gacaggcacg tttaatgtct gggaagcatc agcccaggct       300
     ggaatcaaag ggtttgtatt ctgtagttcc gtatctgttt acggggaaag cagacgtcct       360
     ccaagggagg atgctgtagt tgcattaagt gagaacatgc ctcttctccc aagtgacatc       420
     tatggattaa ctaagtttct tggagaggag atgtctagat attatgtgcg tcgctatggg       480
     gtgccagctg tcgcgcttag gttaggtatg tttactccag aacctttctt cagacacggt       540
     attcgcttac tctatggtgg tgttgatcct cgagatgttg ctcaggctgt gctcaagtcc       600
     atccaggcta tggaagcagg taagataaga tgggaagtgc taaatatagc ctcagaagtg       660
     ccttttacca aagaagatgg tcctcagctt aggaagaatc ctttgcctgt gcttgataaa       720
     tactacaaag atgctgtcaa cttgttgaaa gagagaggag ttgagaggct atatccaatt       780
     cacgaattca tcccaataag taaggctgag gagaaattgg gtttcaggcc agagtataac       840
     ttctcttggt ggctgcaaga gttggagcag catccagact acaggacacc taagaatccg       900
     ccctggcctt ag                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page