(data stored in ACNUC7421 zone)

EMBL: CP001825.PE249

CP001825.PE249       Location/Qualifiers
FT   CDS_pept        267402..267722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41173"
FT                   /db_xref="GOA:D1CE17"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE17"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41173.1"
FT                   /translation="MKEIVPSISNQSKALVPLKSALRTSSRGLLTRLISSRVGVPAALI
FT                   AGGAIGGALVSNTVRRLIINGKQPPAHEKRSFIIQMTRLRVITPGLGHETLTYRVVRAD
FT                   EE"
     atgaaagaga tagtaccaag cattagtaac cagagtaagg ctttggtccc actcaagtcc        60
     gcccttagga ccagctcacg tggactgctt acccgactga tatcaagtag agtaggtgtc       120
     ccggcagcac taatagcagg cggagcgata ggaggagctt tagtcagcaa tactgtaaga       180
     agattaataa taaatggaaa acaacctcct gcccacgaga aaaggtcctt tatcatacag       240
     atgaccaggc ttcgagtaat aacgccagga cttgggcatg aaaccttaac ctacagagta       300
     gtaagagctg atgaagagta a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page