(data stored in ACNUC7421 zone)

EMBL: CP001825.PE25

CP001825.PE25        Location/Qualifiers
FT   CDS_pept        complement(26737..27081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40949"
FT                   /db_xref="GOA:D1CDE3"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDE3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ40949.1"
FT                   /translation="MQSNKGNESNLARYAFSSLLVGIFCAILLISGAITNEILVVPKGY
FT                   GRTFSTFGWIVLIILALSAVTGHVLGLIAFADEKVRSRKVKGVEKAFASIVVGWVLFVA
FT                   ILLLILFVGV"
     atgcagtcta ataaaggtaa cgagagtaac ctggctcgct atgctttcag tagtctgtta        60
     gttggtatat tttgcgccat attgttgatc agtggggcta taactaatga aatcctcgta       120
     gttcccaagg gttatggcag aaccttctcg acgtttggtt ggatagtact gataatcctt       180
     gcactttcag ctgtgaccgg gcacgtactt ggactgatag cctttgctga tgaaaaggta       240
     cgcagtcgta aggtgaaagg ggtagagaaa gcctttgcca gcatcgttgt aggctgggtg       300
     ttattcgtgg ccattctact gctcatcctt tttgtagggg tatag                       345
//

If you have problems or comments...

PBIL Back to PBIL home page