(data stored in ACNUC7421 zone)

EMBL: CP001825.PE252

CP001825.PE252       Location/Qualifiers
FT   CDS_pept        complement(269580..270092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0254"
FT                   /product="Rubrerythrin"
FT                   /note="PFAM: Rubrerythrin; Ferritin Dps family protein;
FT                   KEGG: nis:NIS_1151 bacterioferritin"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41176"
FT                   /db_xref="GOA:D1CE20"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE20"
FT                   /inference="protein motif:PFAM:PF02915"
FT                   /protein_id="ACZ41176.1"
FT                   /translation="MAMHTTSSHSIYAEENAAKREKIIQLLTKAYWMEIESVMNYITNS
FT                   VNPDGVRAREITEALSQDIQEELGHAQMFASRIKELYGVVPGSMDFKPEQSYLQPPENQ
FT                   TDIVHVIKGVIEAEKGAIEFYTQILHETEEVDLVTQDMVIDILHDEQGHLRLFEGFLRE
FT                   YEAEGKA"
     atggctatgc acactacctc ttctcacagc atatatgctg aagaaaatgc tgctaagaga        60
     gaaaagataa tccagctctt aaccaaggct tattggatgg aaattgagtc tgtgatgaat       120
     tacataacca actccgtcaa cccggacggt gtgagggcaa gagagatcac tgaagctcta       180
     tctcaagata tacaggaaga gctcgggcat gcacagatgt ttgcttctag aataaaggag       240
     ttgtacggtg tggtgcctgg ctccatggac ttcaagcctg agcagagtta tctacagcct       300
     ccagagaacc agacagatat cgtccatgtc attaaagggg taatagaggc ggagaaggga       360
     gctatagaat tctacacgca gatactacat gagactgaag aagtagatct ggtgactcaa       420
     gatatggtca tagatatact ccatgatgag cagggacatc ttaggctatt tgagggcttt       480
     cttcgagagt atgaggcaga aggaaaggcc taa                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page