(data stored in ACNUC7421 zone)

EMBL: CP001825.PE26

CP001825.PE26        Location/Qualifiers
FT   CDS_pept        complement(27108..29180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0027"
FT                   /product="1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate
FT                   synthase"
FT                   /EC_number="1.17.7.1"
FT                   /note="KEGG: Os02g0603800; hypothetical protein; K03526 4-
FT                   hydroxy-3-methylbut-2-en-1-yl diphosphate synthase;
FT                   TIGRFAM: 1-hydroxy-2-methyl-2-(E)-butenyl 4- diphosphate
FT                   synthase; PFAM: IspG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40950"
FT                   /db_xref="GOA:D1CDE4"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR017178"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDE4"
FT                   /inference="protein motif:TFAM:TIGR00612"
FT                   /protein_id="ACZ40950.1"
FT                   /translation="MVKSQEVTSNRYCVDPYSYKRRCTHEVMVGNVGVGGNNPIRVQSM
FT                   TTTRTKDVESTVNQIVSLARVGCEIVRVTTPTPADARAIKDIKKELQSKNIHIPIVADV
FT                   HFSPHAAMEAALWADKVRINPGNFADTKLFHIKEYTDEEYAKHLEKIAEKLYPLVMRCK
FT                   ERGISMRIGTNHGSLSDRIMSRYGDTPLGMVESALEFVRMCEEWGYKDIILSMKASNPK
FT                   VMIAAYRLLAARMLEYGMTYPFHLGVTEAGNGEDGRIKSAIGIGTLLEDGIGDTVRVSL
FT                   TEDPENEIPFAYELVKRYAYGIVPDSDEATSIDPLPDLRSPFDYSPRPTRKIFLGEHVL
FT                   GANNPPLVLYKQSSPLSINGVVSINRPVGRDSLRADALSLEVVSEKDRDVFQTSASGLQ
FT                   FASNKPALIATLRFPVDVRDIEAAAYMCSIERGQEDRLSTVARLAVEHKRPLVLELIAN
FT                   IAHDQARDLEGKHDYSVVDELISYALKVEQFGVNDLILALRIPDRSYRIRAYRLLDSRL
FT                   RELGKDWNLLLTVTEDDLIDASIGLGSLLCDGIGSMVSIEGNKPYEEKISLVFNILQAS
FT                   GARISKAEFIACPSCGRTLFDLQTTTEKIKSKTGHLKGVKIAVMGCIVNGLGELADADF
FT                   GYMGSGEGKVNLFVGKTCVEKNVPEEIAADKLVDLIKAHGRWIDPPDNNSSMHDS"
     atggtgaaaa gtcaggaagt tactagcaac aggtattgcg tagaccctta ctcctacaag        60
     aggcggtgta ctcatgaggt aatggttggt aatgtgggag ttgggggaaa taatccaata       120
     agagttcagt cgatgaccac aaccaggaca aaggatgtgg aatcgactgt taatcagatc       180
     gtgtccttgg cgagagtggg ctgcgagata gtgagagtta ctactcccac gcctgctgat       240
     gccagggcca taaaggatat caagaaggag cttcagtcca agaatataca cattcctata       300
     gtggctgatg ttcatttcag tcctcatgca gcgatggagg ctgcgctatg ggcggacaaa       360
     gtaaggatca acccgggtaa ttttgcggac actaagctct ttcacataaa agagtacacc       420
     gatgaggagt atgctaagca tctggagaag atagctgaga agctatatcc tctggtgatg       480
     cgttgtaagg agaggggaat atcgatgcgc attggcacta atcatggttc cctctccgac       540
     aggataatgt ccaggtatgg tgataccccg ctgggcatgg tggagtccgc cctcgagttt       600
     gtgcgtatgt gtgaagagtg gggatacaag gacataatac tttctatgaa agcctctaat       660
     ccaaaggtaa tgatagctgc ctataggctt ctcgctgcca ggatgctcga gtacggcatg       720
     acttatccct tccacttggg tgtcacagag gctggcaatg gtgaagatgg acgcatcaag       780
     tcagctattg gtataggtac tttgcttgag gatgggatag gtgacactgt aagggtttcc       840
     cttactgaag accctgaaaa cgagatccca ttcgcctacg aactagtcaa gcgatatgct       900
     tatggtatag tcccagacag tgatgaagcc acatctatag atcctctgcc ggatcttagg       960
     tcaccttttg actattctcc aagaccgacc aggaaaatat tcctgggaga gcacgtgctt      1020
     ggagctaata atcctcctct agtgctctac aagcagtcgt ctcctctatc aattaacggg      1080
     gtagtcagca taaataggcc cgttggtcgc gatagcctga gggcagatgc attgtctctg      1140
     gaggtggtat ctgagaagga cagggacgtt tttcagacgt cagctagtgg tttacagttc      1200
     gcatccaaca agccagcctt gatcgctacc cttcgattcc ctgtggatgt gagagatatt      1260
     gaagccgcgg cctacatgtg ttctatagaa cggggacaag aggataggtt gtctacggtt      1320
     gcacggcttg ccgttgagca caagcgtccg cttgttctag aacttatcgc taatattgcc      1380
     catgatcaag cgcgcgatct tgagggtaag catgattatt ctgtggttga tgagctgata      1440
     agttatgcac tgaaggtcga gcagtttggg gtaaatgatc ttatccttgc cctgagaata      1500
     cctgatagat cttaccgtat cagggcctat aggctactag attcgaggct aagggagcta      1560
     gggaaagatt ggaacctcct tttgacggtc accgaagatg acctgataga tgcctcgatt      1620
     ggcctcggtt ctctattgtg cgatggtata ggctctatgg tttctataga aggcaataaa      1680
     ccctatgagg aaaagataag cttggtgttc aatatcctcc aggcttctgg tgctaggatc      1740
     agcaaggcgg agtttatagc ctgccctagc tgtggtagaa cgctctttga tttacagacg      1800
     accaccgaaa agatcaagag taagactggt catttgaaag gcgtcaaaat agctgtgatg      1860
     ggttgtatcg tgaatggcct tggggagctg gcagatgctg acttcggcta tatgggaagc      1920
     ggcgagggta aagtaaatct atttgtgggc aagacctgcg ttgagaagaa tgtgccggaa      1980
     gaaatagctg cagacaaact ggtggatttg atcaaggctc atggcaggtg gatcgatcct      2040
     ccagacaata actcctctat gcatgactcc tag                                   2073
//

If you have problems or comments...

PBIL Back to PBIL home page