(data stored in ACNUC7421 zone)

EMBL: CP001825.PE260

CP001825.PE260       Location/Qualifiers
FT   CDS_pept        277640..278863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0262"
FT                   /product="Pyrrolo-quinoline quinone"
FT                   /note="PFAM: Pyrrolo-quinoline quinone; SMART:
FT                   Pyrrolo-quinoline quinone; KEGG: aba:Acid345_4167
FT                   pyrrolo-quinoline quinone"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41184"
FT                   /db_xref="GOA:D1CE28"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE28"
FT                   /inference="protein motif:PFAM:PF01011"
FT                   /protein_id="ACZ41184.1"
FT                   /translation="MISKFVRSAYSQTKLILFGIIAVVALLYAILRTGLSFTLPHALTD
FT                   EKSKITSSKSWPMEGFNPARTRSVNYELSPPLRQIKVISLRDDVGTGSPPAIANNTLFI
FT                   DSNKSLRAIDERKARELWALPLAGEYLSPALYKGLVIIRSESANQGQVLALDVQTGRIR
FT                   WAFQPRRISSASNDYWGGHITSPVIVDDEVFIGAGKELYALDAGTGTILWEYDMADYVS
FT                   SSAAVDKNKVVISDAQYLYAIDKNNGKLIWKTPIKFSVFFSPVIAEGYILATSDKSIVV
FT                   ADLQSGKQVWTKAIAGETLIPVGTDGKLAFAKSSWTLRAFDLKTGRELWAYKDGNFVSM
FT                   PVITKTNIFVVSGVSAQTHIRCLEKSTGKVLWSLSYPNLSNASPVLSDGKLYVRTSKGQ
FT                   VIIFSPQG"
     atgataagca aattcgttag atctgcatac tcacaaacta agctgatttt gttcggcatt        60
     atagctgtgg ttgccttact atatgcaatc ctaagaactg gtttgagctt taccttacct       120
     catgctctaa cagacgagaa aagcaaaata acttctagta aatcctggcc catggaagga       180
     ttcaacccgg ctagaacaag aagtgtgaac tatgaattat ctccgccact tagacagatc       240
     aaagtaatat ccttgagaga tgatgttggc acaggatctc caccagctat agcaaacaac       300
     actttattca tcgactctaa caaatcacta agagctatag acgaaaggaa agccagagag       360
     ctatgggcat tgcccttagc aggagaatat ctatcaccag cgctatacaa aggattagtg       420
     ataattagat ccgagagtgc aaatcaaggc caagtattag ccttagatgt acaaactggg       480
     agaattagat gggcatttca acctcgtaga ataagcagcg caagtaatga ctactgggga       540
     ggacacatca cgtctccagt aatagtggat gacgaggtct tcataggagc cgggaaagaa       600
     ctctacgcac tagatgcggg caccggcaca atcttatggg aatacgatat ggcagattat       660
     gtatcctcat ctgctgcagt agacaaaaac aaagttgtaa tatcagatgc ccaatactta       720
     tatgcaatag acaaaaacaa tggcaagttg atctggaaga cacctatcaa gttttcagta       780
     ttcttttccc cagtgatcgc tgaaggatat atcctagcaa ccagtgacaa atctatagtt       840
     gtagctgatc tacagagtgg caagcaagtg tggaccaagg caattgcagg tgaaacactg       900
     ataccagttg gaacagatgg caaactagct tttgcgaaat catcttggac tctgagagct       960
     ttcgatttga aaacgggaag ggaactttgg gcttataaag atggcaactt tgtctctatg      1020
     cctgtgataa ccaaaactaa tatctttgtt gtaagtggag tatctgcgca aacccacata      1080
     aggtgtttgg agaaaagcac gggcaaagtt ttgtggagcc tttcctatcc aaatttatcg      1140
     aacgcttccc ctgtgttatc ggacggcaaa ttatacgtaa gaacctctaa agggcaggta      1200
     ataattttct ctcctcaggg gtag                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page