(data stored in ACNUC7421 zone)

EMBL: CP001825.PE262

CP001825.PE262       Location/Qualifiers
FT   CDS_pept        279959..280882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0264"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sme:SM_b20969 putative
FT                   sugar uptake ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41186"
FT                   /db_xref="GOA:D1CE30"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE30"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ41186.1"
FT                   /translation="MAEITTRPTVARPQVNFWQNKKFQDRAITIGATILCIIGVIIILF
FT                   PVAWMLSTALKTRAEVARFPPTWIPADPQWINFRDALFSTENPFPTYFKNTMFYALMAM
FT                   IGETLSCAFIAYGFARLRAPGKDILFLLVLATMMLPWQVTLIPQYVMFVKLDRMHFLGL
FT                   DWINSYAPLIVPKFFGSSYLIFMLRQFYRGLPKDYEEAAIMDGANYLNIWARIILPLSK
FT                   PALGAVAILSFMYHYNDFMGPLLYINDNAKYPVSLGLQQFRAPFGGTAWHLLMAASLVT
FT                   VLPPVIVFFVAQRYFIQGIVISGVKG"
     atggcagaga taactactag accaacagtt gccaggccac aggtaaattt ctggcagaac        60
     aagaaatttc aagatagagc catcactata ggggctacta ttctatgcat aatcggggtt       120
     atcataatcc tgtttcccgt tgcatggatg ctatcaaccg ctctaaagac cagagcggaa       180
     gtagccaggt ttccacctac atggatacca gcggatcctc agtggataaa ctttagggat       240
     gctctcttct ctactgagaa cccattccct acatacttca agaacactat gttctacgcc       300
     ttaatggcta tgattggaga aacactctcc tgtgctttca tagcctatgg gttcgcacgc       360
     ctcagggctc cgggaaagga tatactcttc ctgctggtac tagctactat gatgttgccc       420
     tggcaggtaa ctctgatccc gcaatatgtt atgttcgtaa aacttgaccg catgcacttt       480
     cttggacttg actggataaa tagttacgcc cccctaattg tgcccaaatt ctttggtagc       540
     tcctatctaa tatttatgtt gagacaattt tatagggggt tgcctaagga ttatgaagaa       600
     gctgccatta tggatggagc aaactaccta aatatatggg ctagaatcat attgcctctc       660
     tctaaacctg cgcttggagc tgtagccatc ctaagcttca tgtatcacta caacgacttc       720
     atgggaccat tgctttatat aaatgacaac gcaaagtatc ccgtatcttt aggtttgcaa       780
     cagttccgag caccttttgg aggaacagct tggcatctat taatggccgc ctctcttgta       840
     actgtgttac ctccagtaat agtcttcttt gtggctcaaa ggtactttat acagggcata       900
     gtcatcagcg gagtgaaggg ctaa                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page