(data stored in ACNUC7421 zone)

EMBL: CP001825.PE267

CP001825.PE267       Location/Qualifiers
FT   CDS_pept        complement(287095..287937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0269"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   scl:sce8243 fumarylacetoacetase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41191"
FT                   /db_xref="GOA:D1CE35"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE35"
FT                   /inference="protein motif:PFAM:PF01557"
FT                   /protein_id="ACZ41191.1"
FT                   /translation="MILTRHWDDDGPRWALDGYYMPRAFKLEMLMQVPAANLQEVLYRL
FT                   STGQEADGHILAPIEPNQEVWASGVTYLRSREARKAESERGDIYDDVYDAERPELFFKA
FT                   IGWRVVGDEGTVGIRSDSAWNVPEPELVLLINNQMEIVGYTAGNDMSSRDIEGSNPLYL
FT                   PQAKVYERSCAIGRGIKISPEGEISSIDIRLTIYRAGSCVFDAETNTAQMKRTLKELVA
FT                   YLGKSMSFPYGVFLMTGTGIVPDEDFTLLEGDEVRVRVGEIQLTNRVITIPDKTRLTR"
     atgatcctta cacgacattg ggatgatgac ggccctaggt gggcccttga tggatactat        60
     atgcctaggg cattcaaact agagatgctc atgcaggttc ctgccgccaa tttacaagag       120
     gtgctttacc gcctgtccac aggtcaagaa gctgatggac atatattggc ccctatagaa       180
     cctaatcaag aagtctgggc cagtggggtg acttacctaa gaagccgcga ggcaagaaag       240
     gctgagtccg agaggggtga tatatacgat gatgtctacg atgcagaaag acctgaattg       300
     ttctttaagg ccattggctg gagggtagtt ggtgatgagg gtactgttgg cataaggtct       360
     gacagcgcct ggaatgttcc cgaacctgaa ttggtgctgt tgatcaataa ccaaatggag       420
     atagtgggtt acactgcagg taatgacatg tcgtcgagag atatagaagg aagtaatccc       480
     ctgtatcttc cacaagccaa ggtttatgag agatcgtgtg cgataggcag gggaatcaag       540
     ataagccctg agggagagat cagcagcatt gatatacgcc tcactatata cagagcgggc       600
     agctgtgtgt ttgatgccga aactaatact gctcagatga aaagaaccct gaaagaattg       660
     gtggcctatc tgggcaaatc tatgtccttt ccctacggcg tgtttctgat gaccggtaca       720
     gggatcgttc ccgatgagga ctttacgctg ctagaaggcg atgaggttcg tgtaagggtg       780
     ggtgagatac agctaaccaa tagagtcata accataccag ataaaactag attgacgagg       840
     tga                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page