(data stored in ACNUC7421 zone)

EMBL: CP001825.PE269

CP001825.PE269       Location/Qualifiers
FT   CDS_pept        complement(288931..290094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0271"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41193"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE37"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACZ41193.1"
FT                   /translation="MQTLRVLFVGGPMYDPLYTRLREFEDAHNIKVEIVATLIHPELNR
FT                   TIAREFSEGTADYDLISTHTKYAPSQMQWLTPVDDVWSIDELSKFNPMTLELARINGEL
FT                   YGIPRNLDVKLLHYRSDMISTPPRTWEELYELAVALRKEDFYGFVFPGKESGLFGHFFE
FT                   LTAMAGGNLFPNPELPEPNATTEASKWAITLLKNLYTRAAPPQTPDWHYDEVAQCFREG
FT                   LAAMSTDWPGGFYTYEDPKLSKIVGKYDLSMYPQGVAGRKVYSSSHTFAIPVTVKDRAA
FT                   AVELLRFLTSRESQAFEARFGTLPARQDSLEDAESECEPGTLQSRRWSLLEETSKFALL
FT                   PPKHKNYPFVEDVIWQNVRQALIGNIDVDQALENINKEGSAAARGES"
     atgcagacct tgagagtatt gtttgtgggt gggcccatgt atgatcctct ttacacacgc        60
     cttagggagt tcgaggatgc tcacaacatc aaggtagaga tagtagccac ccttattcat       120
     ccggagctta acaggacgat tgctagggag tttagtgagg gtactgcaga ttacgacctg       180
     atatccaccc acactaagta tgctccaagt cagatgcagt ggcttacccc agtggatgat       240
     gtatggtcta tagatgaact ctctaagttc aatcccatga ccctggagtt agcacgaatt       300
     aatggggagc tttatggtat acccaggaat cttgacgtca agttactaca ctacagatcg       360
     gacatgataa gtacccctcc tagaacatgg gaagaattgt acgagcttgc ggtggcgctt       420
     agaaaggaag atttctatgg ctttgtcttc cctgggaagg aatctgggtt attcggccac       480
     tttttcgagt tgactgcgat ggccggaggt aatcttttcc ccaatcctga actgccagaa       540
     ccaaatgcta ctactgaggc ttccaaatgg gctatcactt tgctgaagaa tctttacacc       600
     cgagctgctc caccacaaac tccagactgg cattatgacg aagtagccca gtgctttcga       660
     gagggattag cggcgatgag taccgattgg cctggaggct tttatactta cgaagatccc       720
     aaactgagca agatagtagg taagtatgac ctgtctatgt atcctcaagg cgtagctggg       780
     cgcaaggttt actctagcag ccataccttt gccatacctg tcacagtaaa ggatagagcg       840
     gctgctgtcg agctcctgcg ttttctaaca tctcgagagt cgcaggcttt tgaggccagg       900
     tttgggactt tgcctgcgag gcaggactct cttgaagatg cagagagtga atgcgaacct       960
     ggtaccttac agagcagaag atggtcatta ctggaagaaa ctagcaaatt cgccttgtta      1020
     ccgcctaaac acaaaaacta tccatttgtt gaagacgtta tctggcagaa cgtcagacaa      1080
     gcgcttattg ggaatataga cgtagaccaa gctcttgaga acataaacaa agagggatca      1140
     gctgcggcca gaggagagtc ttaa                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page