(data stored in ACNUC7421 zone)

EMBL: CP001825.PE270

CP001825.PE270       Location/Qualifiers
FT   CDS_pept        290193..291161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0272"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: ret:RHE_CH00494
FT                   L-fucose dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41194"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE38"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ACZ41194.1"
FT                   /translation="MEKQQTLPLRPLGSTGLQVTPICVGCAELGNMPETFAYSVEEEIA
FT                   LQTIREAFKSPINFMDTAAAYGDGESERRIGIVIREMGGLPPNYVLATKADRNLQTGDF
FT                   SGEQIKRSIERSLNLLGLDKLQLVYLHDPEHSTFEYITSKGGAIDTLVAYKDQGVIEHI
FT                   GIAGGPIDMMIRYVELDVFEAVITHNRYTLINRSAEPLIDLAHKKGLAVVNAAPYGSGI
FT                   LAKGPDAYPRYAYQEAPDKILNRVRVIDEVCKRYGVPIAAVALHFSLRDPRITSTIVGM
FT                   SKPERIRQTIDLVNTHIPAGVWEELEPLDYDTEDPEANRWK"
     ttggagaagc agcaaacact ccctctaagg ccattgggta gtacaggatt acaagttacg        60
     ccgatatgtg tgggctgtgc agagctaggc aacatgccag agacttttgc ctattcggta       120
     gaagaagaaa tagccctgca aactattagg gaagcattca aaagcccaat aaatttcatg       180
     gatacagctg cagcctatgg agacggtgag agcgagcggc gtataggtat cgttataaga       240
     gagatgggcg gactcccacc aaactacgtg ctggcaacta aggcagatcg taacttacag       300
     acaggtgact ttagcggaga gcagatcaag agatctatag agagaagcct aaatttattg       360
     gggctggata aactccagct cgtatacctg catgatcctg agcactctac gttcgaatac       420
     ataacatcga aaggcggagc tattgatacc ctagtggctt ataaagacca aggggtcatt       480
     gaacatatag gcatcgcggg cggacctatt gacatgatga tacgttacgt agagctagat       540
     gtgtttgagg ctgtaataac tcacaataga tataccttga tcaacagaag tgctgaacca       600
     ttgatagacc tcgcccataa gaagggcttg gcagttgtaa atgcagctcc ctatggcagc       660
     ggtatacttg ccaaagggcc agatgcctat cctagatacg cctaccaaga agcccctgac       720
     aagatattga atagagtaag agttatagat gaagtttgta agagatatgg cgtgccgata       780
     gctgctgtgg ctcttcactt ctctctaagg gatccaagaa taacatccac cattgttggt       840
     atgagcaagc ctgaaagaat taggcaaact atagacctag taaacactca tatacctgca       900
     ggggtctggg aagaacttga acctctagat tatgatacag aggatcctga agcaaacaga       960
     tggaagtga                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page