(data stored in ACNUC7421 zone)

EMBL: CP001825.PE271

CP001825.PE271       Location/Qualifiers
FT   CDS_pept        291217..292053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0273"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: sus:Acid_1947 xylose isomerase domain- containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41195"
FT                   /db_xref="GOA:D1CE39"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE39"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ACZ41195.1"
FT                   /translation="MNNRISCHLITWGNDLLTGMKEASELGFQACETFTHQALEYENRV
FT                   EEFRELLGSYDLELSALYGGGRFSDPSKEAEVIAYNTRVAQFLSKLGVDRIVFGPGGPR
FT                   EGKTSLEGLKQMAKTINEAAKRTYDLGVLACVHPHLGTELQDEDELDAVMEMTDDRYVF
FT                   FCPDTAHLTAAGMNAAEIIRRYGNRMRYMHLKDLTPENPDPSVFTAFSGTEALPIFCEL
FT                   GLGTIDFVPIMQALQDVGYDGWLTVEIDQSTSTPYQSLKQCRDFVQDKLGISIRYR"
     atgaacaatc ggatatcctg tcatctcatt acctggggga acgatctatt gacaggcatg        60
     aaggaggcct cagagttagg cttccaagct tgcgagactt ttactcacca agcactggaa       120
     tacgaaaaca gggtagagga atttagggaa cttctaggat cttatgatct ggagctgtcg       180
     gctctgtatg gaggtggtag attcagtgat ccctccaaag aggcagaagt cattgcctat       240
     aacactcgag tagcgcagtt tctatcgaag ttaggcgttg accgcattgt atttggccca       300
     ggaggaccta gggaaggcaa gaccagcctt gaaggactga agcaaatggc aaagacaatc       360
     aacgaagctg ccaagagaac gtacgactta ggggtgcttg catgcgtgca cccacattta       420
     ggtactgagc ttcaggatga agatgagctc gatgccgtaa tggagatgac agacgacaga       480
     tacgtcttct tctgccctga cacggctcac ctgacggctg cgggtatgaa tgcggcagag       540
     atcataagaa gatacgggaa caggatgaga tacatgcatc ttaaggacct aacccccgag       600
     aatcctgatc cgagcgtatt cacagctttc tctgggacgg aagctttgcc tatattttgt       660
     gagctagggc tcgggacgat cgattttgtt ccgataatgc aggcgctaca agacgtagga       720
     tacgatggat ggcttaccgt ggagattgac cagtcaacca gtactcccta ccaaagtctg       780
     aagcagtgtc gagacttcgt gcaagataaa cttggaatat ctataaggta caggtga          837
//

If you have problems or comments...

PBIL Back to PBIL home page