(data stored in ACNUC7421 zone)

EMBL: CP001825.PE272

CP001825.PE272       Location/Qualifiers
FT   CDS_pept        292059..293096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0274"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: probable dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41196"
FT                   /db_xref="GOA:D1CE40"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE40"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACZ41196.1"
FT                   /translation="MSFKIGIIGCGRIVEEGHAPALSNMRHVAEVVALADPSPERRATI
FT                   ENVLNYKVSGQYSSWKDLLENTPNLDAVLIALPHHLHEPAITDAARFGVNVISEKPLAA
FT                   TLEEVDRIGAVIKEHNVKLAVIHNYTYSRPMRYALRAIQEGRVGEVFLVRSEGLAGSHY
FT                   KGKDPSNPDWRTQSTRGGGGVLLDNGYHNMYVAEAEAQSPVIKVYARVGRYVREQDVDD
FT                   LAVVMLTHENGATTVVEVAWAVNGGGAFVHEVHGKLGSIRFKIEAPFVEIYENKIGQWL
FT                   PLSYADDNFQEGFHGVLQDIFNAWAQGEDAPTNLAKARHNLAILRAAYLSAQQGTVVDL
FT                   KDVER"
     atgagcttca agataggcat aataggctgc ggcaggatcg tggaggaggg gcatgcacca        60
     gcactaagta atatgaggca tgttgctgag gtggtagccc tggcggatcc tagccctgag       120
     cgacgggcaa ctatagaaaa tgtcctcaac tataaagtaa gtgggcaata tagctcctgg       180
     aaagacctac tagagaatac gccaaatctg gatgcagtac ttatagccct cccgcatcac       240
     ctccatgaac cggctatcac agatgcagct agatttggcg tgaatgtgat atctgagaaa       300
     cctttggctg ccacattgga ggaggtcgat cgtataggag cagtcattaa ggaacataac       360
     gtaaagctgg cagtcatcca taattacact tacagccgcc ccatgagata tgctctaaga       420
     gcaattcagg aaggccgtgt aggagaggta tttcttgtga ggagtgaggg tcttgccggt       480
     agtcactaca agggcaagga tccttctaat cccgactgga gaacgcagtc cacaagaggt       540
     gggggcggtg tgctcctgga caatggttac cacaacatgt acgtagcaga agcggaagct       600
     caaagcccag taataaaggt ctacgcaagg gtcgggcgtt atgtacgaga gcaagatgtg       660
     gacgatcttg ctgtagtgat gctcacccat gagaacggcg ctactaccgt agttgaagta       720
     gcttgggcgg tcaatggagg tggagcattc gtacatgaag tacatggaaa gctcggtagt       780
     ataagattca agatagaagc accatttgtc gagatatatg aaaacaagat aggacaatgg       840
     ctgcctctaa gctatgccga cgataacttc caagagggtt ttcatggtgt gctacaagat       900
     atattcaacg cctgggcaca aggcgaggac gctcccacaa atctagccaa ggcaaggcat       960
     aatctagcta ttctcagggc tgcatatcta tcggctcagc agggaactgt cgtagatctc      1020
     aaagacgtag agcgctaa                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page