(data stored in ACNUC7421 zone)

EMBL: CP001825.PE276

CP001825.PE276       Location/Qualifiers
FT   CDS_pept        298413..299171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0278"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: azo:azo3286 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41200"
FT                   /db_xref="GOA:D1CE44"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE44"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ41200.1"
FT                   /translation="MRPESSSQTHPDSWLLDKDGFKQPAIQVVDVVRKYKVGSEEVQAL
FT                   RGINLTVPEGQFVALMGRSGSGKTTLLNIIGGLDRPTTGEVFISGQSLSNLSEGELTKL
FT                   RRSQFGFVFQSFALIPILSAAENVELPLRIAGKYSLRERKQRVMEALSLVGLAKWAEHR
FT                   PYEMSGGQQQRVAIARALVTRPKILIADEPTGELDSKTGQMVLNLLRKVVDESKVTLVM
FT                   ATHDPAVEEYADVLYRMQDGQIIDTLIKTM"
     atgaggcccg aatcaagttc ccagacacac cctgatagct ggttattgga caaggatggg        60
     tttaaacagc ctgccataca ggttgtagac gtggttcgga aatataaggt aggcagcgaa       120
     gaggtgcaag ctctcagggg aataaatttg actgtgcctg aaggacagtt cgtggctctg       180
     atgggacgct cgggctcagg gaaaacaaca ttgctcaaca tcataggggg gctagataga       240
     cctacaactg gagaggtatt tatatcagga caatccctta gcaacctctc tgaaggcgag       300
     ttaactaagt tgaggcgtag ccaatttggt ttcgtatttc agtcatttgc gcttataccg       360
     atactgtctg ctgctgagaa cgtagaactc cccctaagga tagccggcaa gtatagcctt       420
     agagagcgta agcagcgagt gatggaagcc ctatctcttg tagggctggc taagtgggct       480
     gagcacaggc catacgagat gtctggaggc cagcagcaaa gagttgctat agctagggct       540
     ttagtcacga gacctaagat actgattgct gatgagccaa cgggagagct ggatagtaaa       600
     actggacaga tggtcctaaa ccttcttaga aaggttgtgg atgaatcgaa agtgacgtta       660
     gtaatggcaa ctcacgatcc agcggtagaa gagtatgctg atgtactcta tagaatgcag       720
     gacggacaga taatagacac cctcataaag actatgtga                              759
//

If you have problems or comments...

PBIL Back to PBIL home page